PaperBLAST – Find papers about a protein or its homologs

 

Align WP_043847943.1 to PF06722 (EryCIII-like_C)

WP_043847943.1 has 408 amino acids

Query:       EryCIII-like_C  [M=145]
Accession:   PF06722.16
Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.4e-20   59.1   2.6    4.5e-20   58.2   1.7    1.9  2  WP_043847943.1  


Domain annotation for each sequence (and alignments):
>> WP_043847943.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.7   0.0      0.26      0.26      82     107 ..      20      45 ..      17      49 .. 0.81
   2 !   58.2   1.7   4.5e-20   4.5e-20      39     122 ..     294     376 ..     284     392 .. 0.86

  Alignments for each domain:
  == domain 1  score: -2.7 bits;  conditional E-value: 0.26
  EryCIII-like_C  82 rarrvaelGagivlskdeltsdsiak 107
                      a r+ e+Ga + +  + + +d++a+
  WP_043847943.1  20 LAVRLRERGAEVRMCAPPDCADRLAE 45 
                     57789999999999888888888876 PP

  == domain 2  score: 58.2 bits;  conditional E-value: 4.5e-20
  EryCIII-like_C  39 vPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivlskdeltsdsiakavaevvedpayraaa 122
                     v  +vl    aa++HhgGag+t+ a  +GvPq+++p+ ad++  a rvaelG g++   ++ t d++ +a+++ ++ ++ r  a
  WP_043847943.1 294 VNQQVLFRRVAAVIHHGGAGTTHVATRAGVPQILVPQIADQPYYAARVAELGVGVAHDGPTPTFDTLSAALTKALAPET-RVRA 376
                     556799999**************************************************************99887544.3333 PP



Or compare WP_043847943.1 to CDD or PaperBLAST