PaperBLAST
PaperBLAST Hits for BRENDA::A0A0H3W5K4 acetaldehyde dehydrogenase (acetylating) (EC 1.2.1.10) (Thermoanaerobacterium saccharolyticum) (859 a.a., MATTKTELDV...)
Show query sequence
>BRENDA::A0A0H3W5K4 acetaldehyde dehydrogenase (acetylating) (EC 1.2.1.10) (Thermoanaerobacterium saccharolyticum)
MATTKTELDVQKQIDLLVSRAQEAQKKFMSYTQEQIDAIVKAMALAGVDKHVELAKMAYE
ETKMGVYEDKITKNLFATEYVYHDIKNEKTVGIINENIEENYMEVAEPIGVIAGVTPVTN
PTSTTMFKCLISIKTRNPIIFSFHPKAIKCSIAAAKVMYEAALKAGAPEGCIGWIETPSI
EATQLLMTHPGVSLILATGGAGMVKAAYSSGKPALGVGPGNVPCYIEKSANIKRAVSDLI
LSKTFDNGVICASEQAVIIDEEIADEVKKLMKEYGCYFLNKDEIKKLEKFAIDEQSCAMS
PAVVGQPAAKIAEMAGFKVPEGTKILVAEYEGVGPKYPLSREKLSPILACYTVKDYNEGI
KKCEEMTEFGGLGHSAVIHSENQNVINEFARRVRTGRLIVNSPSSQGAIGDIYNTNTPSL
TLGCGSMGRNSTTDNVSVKNLLNIKRVVIRKDRMKWFKIPPKIYFESGSLQYLCKVKRKK
AFIVTDPFMVKLGFVDKVTYQLDKANIEYEIFSEVEPDPSVDTVMNGVKIMNSYNPDLII
AVGGGSAIDAAKGMWLFYEYPDTEFETLRLKFADIRKRAFKFPELGKKALFIAIPTTSGT
GSEVTAFAVITDKKRNIKYPLADYELTPDIAIIDPDLTKTVPPSVTADTGMDVLTHAIEA
YVSVMASDYTDALAEKAIKIVFEYLPRAYKNGNDEEAREKMHNASCMAGMAFTNAFLGIN
HSMAHILGGKFHIPHGRANAILLPYVIRYNAEKPTKFVAFPQYEYPKAAERYAEIAKFLG
LPASTVEEGVESLIEAIKNLMKELNIPLTLKDAGINKEQFEKEIEEMSDIAFNDQCTGTN
PRMPLTKEIAEIYRKAYGA
Running BLASTp...
Found 250 similar proteins in the literature:
A0A0H3W5K4 acetaldehyde dehydrogenase (acetylating) (EC 1.2.1.10) from Thermoanaerobacterium saccharolyticum (see paper)
I3VSF1 alcohol dehydrogenase (EC 1.1.1.1); L-lactate dehydrogenase (EC 1.1.1.27); acetaldehyde dehydrogenase (acetylating) (EC 1.2.1.10) from Thermoanaerobacterium saccharolyticum (see paper)
Tsac_0416 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Thermoanaerobacterium saccharolyticum JW/SL-YS485
100% identity, 100% coverage
- Conversion of phosphoenolpyruvate to pyruvate in Thermoanaerobacterium saccharolyticum
Cui, Metabolic engineering communications 2020 - “...strains. Table3 Strain Gene Product Type c CDS change d AA change Frequency e LL1580 Tsac_0416 AdhE a SNV 1790C>A T597K 100% LL1580 Tsac_1793 FliN b SNV 1065C>A F355L 100% LL1580 10 bp upstream of Tsac_1881 transcriptional regulator, RpiR family SNV C>T 100% LL1686 Tsac_2318 Uma2...”
- The redox-sensing protein Rex modulates ethanol production in Thermoanaerobacterium saccharolyticum
Zheng, PloS one 2018 - “...these mutations only occurred in one of the four adapted strains, but mutations in adhE (Tsac_0416), trx (Tsac_0492), Auxin efflux carrier (Tsac_2140), and rpoN (Tsac_2488) appeared frequently, appearing in at least three out of four adapted strains. In particular, adhE accumulated three different mutations, as well...”
- “...Misc 430181 SNV C A, Glu454 * 0% 0% 99% 0% 184 bp upstream of Tsac_0416 adhE AdhE, Alcohol dehydrogenase, iron-type Carb 447044 INS - AT 0% 38% 0% 20% Tsac_0416 449017 SNV C A, Thr597Lys 57% 0% 0% 0% SNV C T, Thr597Ile 30% 0%...”
- Deletion of the hfsB gene increases ethanol production in Thermoanaerobacterium saccharolyticum and several other thermophilic anaerobic bacteria
Eminoğlu, Biotechnology for biofuels 2017 - “...strains (Fig. 5 ). It is also directly adjacent to adhE on the chromosome ( tsac_0416 locus), although they are transcribed in opposite directions. This protein is annotated by PFAM as unknown function [ 23 ]. A BLAST search revealed only 5 close matches in the...”
- Both adhE and a Separate NADPH-Dependent Alcohol Dehydrogenase Gene, adhA, Are Necessary for High Ethanol Production in Thermoanaerobacterium saccharolyticum
Zheng, Journal of bacteriology 2017 - “...genes Gene locus Tsac_0218 Tsac_2222 Tsac_0285 Tsac_1049 Tsac_2087 Tsac_0416 Tsac_0219 aSeq Gene name Seq IDa I3VRV9 I3VXI1 I3VS20 I3VU69 adhA I3VX46 adhE...”
- Development of a plasmid-based expression system in Clostridium thermocellum and its use to screen heterologous expression of bifunctional alcohol dehydrogenases (adhEs)
Hon, Metabolic engineering communications 2016 - “...(2011) pLL1122 C. thermocellum adhE D494G P525L This study pLL1123 T. saccharolyticum wild type adhE (Tsac_0416) This study pLL1124 T. saccharolyticum adhE V52A K451N; 13 aa repeat, also known as ALK2 Shaw et al. (2008b) pLL1125 T. saccharolyticum adhE G544D This study pLL1126 T. mathranii wild...”
- Strain and bioprocess improvement of a thermophilic anaerobe for the production of ethanol from wood
Herring, Biotechnology for biofuels 2016 - “...SNV A C Yes Phe 104 Val PWT 100 100 100 Altronate oxidoreductase 15 adhE Tsac_0416 448858 SNV G A Yes Gly 544 Asp PWT 98 100 100 Bifunctional alcohol/aldehyde dehydrogenase 16 Tsac_0838 884294 Deletion T Yes Ser 102 FS PWT 85 99 100 Protein of...”
- “...2 Yes Tsac_0079 Uncharacterised conserved protein UCP018688 2 Yes Tsac_0361 S-layer domain-containing protein 4 adhE Tsac_0416 Bifunctional alcohol/aldehyde dehydrogenase 4 Yes Tsac_0644 Hypothetical protein 2 Tsac_0653 Methionyl-tRNA synthetase 2 Tsac_0825 Inorganic diphosphatase 2 Tsac_0838 Protein of unknown function DUF324 3 Yes Tsac_1263 PTS system transcriptional activator...”
- Deletion of nfnAB in Thermoanaerobacterium saccharolyticum and Its Effect on Metabolism
Lo, Journal of bacteriology 2015 - “...subterraneus subsp. tengcongensis Thermoanaerobacter kivui Tsac_0416 (100) Tthe_2646 (97) Teth39_0206 (86) Teth514_0627 (86) Tmath_2110 (85) Thebr_0212...”
- The bifunctional alcohol and aldehyde dehydrogenase gene, adhE, is necessary for ethanol production in Clostridium thermocellum and Thermoanaerobacterium saccharolyticum
Lo, Journal of bacteriology 2015 - “...1. The adhE gene in T. saccharolyticum (Ts_adhE; Tsac_0416) was deleted by allelic replacement using standard techniques in parent strain JW/SLYS485 (21, 22),...”
- Both adhE and a Separate NADPH-Dependent Alcohol Dehydrogenase Gene, adhA, Are Necessary for High Ethanol Production in Thermoanaerobacterium saccharolyticum
Zheng, Journal of bacteriology 2017 - “...Seq IDa I3VRV9 I3VXI1 I3VS20 I3VU69 adhA I3VX46 adhE I3VSF1 I3VRW0 Length (aa) 404 373 390 394 400 860 468 Gene product description Alcohol dehydrogenase...”
V518_0444 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Thermoanaerobacterium aotearoense SCUT27
100% identity, 100% coverage
- Engineered Thermoanaerobacterium aotearoense with nfnAB knockout for improved hydrogen production from lignocellulose hydrolysates
Li, Biotechnology for biofuels 2019 - “...kinase, ( ack , accession no. V518_1311); bifunctional acetaldehyde-CoA/alcohol dehydrogenase, ( adhE , accession no. V518_0444); alcohol dehydrogenase, ( adhA , accession no. V518_0933); alcohol dehydrogenase, ( adhB , accession no. V518_1046). Although PFL has been found in T. aotearoense SCUT27, no formate was detected during...”
A0A0H3W5V0 alcohol dehydrogenase [NAD(P)+] (EC 1.1.1.71) from Thermoanaerobacterium saccharolyticum (see paper)
100% identity, 100% coverage
Tthe_2646 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Thermoanaerobacterium thermosaccharolyticum DSM 571
D9TMP1 Aldehyde-alcohol dehydrogenase from Thermoanaerobacterium thermosaccharolyticum (strain ATCC 7956 / DSM 571 / NCIMB 9385 / NCA 3814 / NCTC 13789 / WDCM 00135 / 2032)
97% identity, 100% coverage
- Consolidated bioprocessing of butanol production from xylan by a thermophilic and butanologenic Thermoanaerobacterium sp. M5
Jiang, Biotechnology for biofuels 2018 - “...7 P29441 Xylose isomerase xylA 50.183 21 D9TTQ7 Xylulokinase Tthe_2491 54.684 5 D9TMP1 Aldehydealcohol dehydrogenase Tthe_2646 94.723 11 D9TP56 Iron-containing alcohol dehydrogenase Tthe_1156 43.352 11 D9TR64 Iron-containing alcohol dehydrogenase Tthe_1821 39.632 3 D9TSE3 Iron-containing alcohol dehydrogenase Tthe_0472 42.453 6 D9TTR6 Iron-containing alcohol dehydrogenase Tthe_2500 43.298 6...”
- Deletion of nfnAB in Thermoanaerobacterium saccharolyticum and Its Effect on Metabolism
Lo, Journal of bacteriology 2015 - “...subsp. tengcongensis Thermoanaerobacter kivui Tsac_0416 (100) Tthe_2646 (97) Teth39_0206 (86) Teth514_0627 (86) Tmath_2110 (85) Thebr_0212 (86) NF NF...”
- Consolidated bioprocessing of butanol production from xylan by a thermophilic and butanologenic Thermoanaerobacterium sp. M5
Jiang, Biotechnology for biofuels 2018 - “...Beta-glucosidase Tthe_1813 51.651 7 P29441 Xylose isomerase xylA 50.183 21 D9TTQ7 Xylulokinase Tthe_2491 54.684 5 D9TMP1 Aldehydealcohol dehydrogenase Tthe_2646 94.723 11 D9TP56 Iron-containing alcohol dehydrogenase Tthe_1156 43.352 11 D9TR64 Iron-containing alcohol dehydrogenase Tthe_1821 39.632 3 D9TSE3 Iron-containing alcohol dehydrogenase Tthe_0472 42.453 6 D9TTR6 Iron-containing alcohol dehydrogenase...”
- “...of strain M5 with predicted molecular mass of 94.7kDa, which was also identified by LCMS/MS (D9TMP1). Furthermore, no aldehyde dehydrogenase (ALDH) within the annotated CDS of strain M5 was identified, which generally could reduce acetyl-CoA/butyryl-CoA to acetaldehyde/butyraldehyde, proving that adhE was the only crucial enzyme for...”
B0K4A2 alcohol dehydrogenase (EC 1.1.1.1); acetaldehyde dehydrogenase (acetylating) (EC 1.2.1.10) from Thermoanaerobacter sp. X514 (see 2 papers)
Teth514_0627 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Thermoanaerobacter ethanolicus X514
87% identity, 97% coverage
- Alcohol dehydrogenases AdhE and AdhB with broad substrate ranges are important enzymes for organic acid reduction in Thermoanaerobacter sp. strain X514
Hitschler, Biotechnology for biofuels 2021 - “...GroES domain protein (Teth514_1882) and the remaining six genes as iron-containing ADH (Teth514_0145, Teth514_0241, Teth514_0564, Teth514_0627, Teth514_0654, Teth514_1935). The major aim of our study was to shed light on the role of ADHs in Thermoanaerobacter sp. strain X514, in sugar fermentation to ethanol and in organic...”
- “...NADH-dependent ALDH/ADH activity as an iron-containing ADH (ABY91935.1). This protein is encoded by the gene Teth514_0627 which shares 100% query cover and 97% identity with a bifunctional ALDH/ADH known as AdhE of the strains T. ethanolicus , T.wiegelii and T.mathranii . Furthermore, the putative AdhE of...”
- The monofunctional CO dehydrogenase CooS is essential for growth of Thermoanaerobacter kivui on carbon monoxide
Jain, Extremophiles : life under extreme conditions 2021 - “...the promoter gyrase from Thermoanaerobacter sp. strain X514, and directly adjacent to the 3-end, gene Teth514_0627 from Thermoanaerobacter sp. strain X514 under control of the promoter of the S-layer protein from T. kivui . pJM006 except for adhE was amplified by PCR using primers (5- CTACTCAATATATAAAATTTAATTTAAAAATTTCACAGCAAGCAG)...”
- Formate Is Required for Growth of the Thermophilic Acetogenic Bacterium Thermoanaerobacter kivui Lacking Hydrogen-Dependent Carbon Dioxide Reductase (HDCR)
Jain, Frontiers in microbiology 2020 - “...promoter controlling gyrase from Thermoanaerobacter sp. strain X514, and directly adjacent to the 3-end, gene Teth514_0627 from Thermoanaerobacter sp. strain X514 under control of the promoter of the S-layer protein from T. kivui . pJM006 except for adhE from Thermoanaerobacter sp. strain X514 was amplified by...”
- Alcohol Selectivity in a Synthetic Thermophilic n-Butanol Pathway Is Driven by Biocatalytic and Thermostability Characteristics of Constituent Enzymes
Loder, Applied and environmental microbiology 2015 - “...pET-21b between the NdeI and XhoI restriction sites. Teth514_0627 (Thermoanaerobacter sp. strain X514 adhE [X514-adhE]) was amplified from gDNA by PCR and...”
- “...CA_C3298 TTE0549 TTE0548 TTE0544 STHERM_c16300 Cthe_0423 Teth514_0627 Teth514_1942 Teth514_1935 Homology to Enzyme query Sequence- SDS- Purityc MMd Molecular...”
- Deletion of nfnAB in Thermoanaerobacterium saccharolyticum and Its Effect on Metabolism
Lo, Journal of bacteriology 2015 - “...kivui Tsac_0416 (100) Tthe_2646 (97) Teth39_0206 (86) Teth514_0627 (86) Tmath_2110 (85) Thebr_0212 (86) NF NF NF Teth39_0218 (100) Teth514_0653 (98) Tmath_2094...”
- Correlation of genomic and physiological traits of thermoanaerobacter species with biofuel yields
Hemme, Applied and environmental microbiology 2011 - “...tag GeneID Teth514_0145 Teth514_0241 Teth514_0564 Teth514_0627 Teth514_0653 Teth514_0654 Teth514_1808 Teth514_1882 Teth514_1935 167038817 167038910 167039223...”
B0KBJ9 alcohol dehydrogenase (EC 1.1.1.1) from Thermoanaerobacter pseudethanolicus (see paper)
Teth39_0206 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Thermoanaerobacter ethanolicus ATCC 33223
87% identity, 97% coverage
- Physiological, metabolic and biotechnological features of extremely thermophilic microorganisms
Counts, Wiley interdisciplinary reviews. Systems biology and medicine 2017 - “...individually inserting two bi-functional alcohol dehydrogenase genes from Thermoanaerobacter pseudethanolicus 39E, adhB (Teth39_0218) and adhE (Teth39_0206), into the C. bescii lactase dehydrogenase knockout 159 . Growing the modified strain at 75C with cellobiose, ethanol was produced at reported levels of 1.4 mM and 2.9 mM, acetate...”
- Cellulosic ethanol production via consolidated bioprocessing at 75 °C by engineered Caldicellulosiruptor bescii
Chung, Biotechnology for biofuels 2015 - “...bescii [ 26 ]. b The T. pseudethanolicus 39E ethanol pathway. The green colored AdhE (Teth39_0206) and blue colored AdhB (Teth39_0218) are expressed and tested in C. bescii in this study Results The adhB and adhE genes from Thermoanaerobacter pseudethanolicus 39E, an anaerobic thermophile that produces...”
- “...from T. pseudethanolicus in C. bescii The T. pseudethanolicus adhE gene (bifunctional secondary ADH/aldehyde hydrogenase, Teth39_0206) and adhB gene (bifunctional secondary ADH/Acetyl-CoA thioesterase, Teth39_0218) were cloned from T. pseudethanolicus 39E under the transcriptional control of the C. bescii S-layer protein (Cbes2303) promoter (P S-layer ) [...”
- Deletion of nfnAB in Thermoanaerobacterium saccharolyticum and Its Effect on Metabolism
Lo, Journal of bacteriology 2015 - “...tengcongensis Thermoanaerobacter kivui Tsac_0416 (100) Tthe_2646 (97) Teth39_0206 (86) Teth514_0627 (86) Tmath_2110 (85) Thebr_0212 (86) NF NF NF Teth39_0218...”
- A comparative multidimensional LC-MS proteomic analysis reveals mechanisms for furan aldehyde detoxification in Thermoanaerobacter pseudethanolicus 39E
Clarkson, Biotechnology for biofuels 2014 - “...three functionally characterized ADHs [ 36 , 44 ], AdhA (Teth39_0220), AdhB (Teth39_0218), and AdhE (Teth39_0206), were all downregulated ( P <0.05); however, none more than twofold (AdhA 1.27-fold, AdhB 1.81-fold, and AdhE 1.59-fold). Of the other three identified alcohol dehydrogenases in T. pseudethanolicus 39E (Teth39_0878,...”
- Linking genome content to biofuel production yields: a meta-analysis of major catabolic pathways among select H2 and ethanol-producing bacteria
Carere, BMC microbiology 2012 - “...4150 CtherDRAFT_2741 CtherDRAFT_2742 CtherDRAFT_2349 CtherDRAFT_1042 CtherDRAFT_0189 CtherDRAFT_1096 CtherDRAFT_0616 CtherDRAFT_2833 Ta. pseudethanolicus 39E Teth39_1296 Teth39_1295 Teth39_0220 Teth39_0206 Teth39_1597 Teth39_1979 G. thermoglucosidasius C56-YS93 Cthe_3862 Geoth_0875 Geoth_0855 Geoth_0268 Geoth_1572 Geoth_3879 Geoth_0879 Geoth_0652 Geoth_1941 Geoth_2349 Geoth_3494 Geoth_0631 B. cereus ATCC 14579 BC5387 BC4637 BC2832 BC0802 BC4365 BC3555 BC2529 BC1285 BC2220...”
- Correlation of genomic and physiological traits of thermoanaerobacter species with biofuel yields
Hemme, Applied and environmental microbiology 2011 - “...gene product GeneID Teth39_1979 167038363 Teth39_0206 Teth39_0218 Teth39_0220 Teth39_2190 Teth39_0878 167036636 167036648 167036650 167038570 167037292...”
Q0PH30 alcohol dehydrogenase (EC 1.1.1.1) from Thermoanaerobacter ethanolicus (see paper)
86% identity, 98% coverage
Tmath_2110 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Thermoanaerobacter mathranii subsp. mathranii str. A3
85% identity, 97% coverage
BCV53_03330 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Parageobacillus thermoglucosidasius
69% identity, 98% coverage
TEMA_20240 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Terrisporobacter mayombei
66% identity, 96% coverage
- Genome-based metabolic and phylogenomic analysis of three Terrisporobacter species
Böer, PloS one 2023 - “...TEPE_30830 TEGL_29820 GroEL groEL TEMA_27370 TEPE_39970 TEGL_38350 Listeria adhesion protein ( Listeria ) lap TEMA_20190; TEMA_20240 TEPE_31700; TEPE_31750 TEGL_30950; TEGL_31000 Polar flagella ( Aeromonas ) fliP TEMA_40940 TEPE_11950 TEGL_11730 flmH - TEPE_06230 TEGL_05600 Type IV pili ( Neisseria ) pilT TEMA_31630 TEPE_02190 TEGL_02200 Regulation CheA/CheY (...”
CRIB_2231 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Romboutsia ilealis
66% identity, 96% coverage
- Genomic and functional analysis of Romboutsia ilealis CRIBT reveals adaptation to the small intestine
Gerritsen, PeerJ 2017 - “...pyruvate-flavodoxin oxidoreductase (CRIB_2021); 21, phosphate acetyltransferase (CRIB_2171); 22, acetate kinase (CRIB_1927); 23, bifunctional aldehyde-alcohol dehydrogenase (CRIB_2231); 24, fatty aldehyde dehydrogenase (CRIB_2231); 25, L-fucose permease (CRIB_1294); 26, L-fucose isomerase (CRIB_1298); 27, L-fuculokinase (CRIB_1297); 28, L-fuculose phosphate aldolase (CRIB_1297); 29, lactaldehyde reductase (CRIB_1300); ?, possible mechanisms of external...”
- “...glucose and FOS, an upregulation was seen for the gene encoding the bifunctional aldehyde/alcohol dehydrogenase (CRIB_2231), which converts acetyl-CoA to ethanol. However, there were no samples in which ethanol was measured by HPLC analysis. During growth on FOS, a small gene cluster (CRIB_601-CRIB_603) that includes a...”
TEGL_31000 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Terrisporobacter glycolicus ATCC 14880 = DSM 1288
66% identity, 97% coverage
- Genome-based metabolic and phylogenomic analysis of three Terrisporobacter species
Böer, PloS one 2023 - “...TEMA_27370 TEPE_39970 TEGL_38350 Listeria adhesion protein ( Listeria ) lap TEMA_20190; TEMA_20240 TEPE_31700; TEPE_31750 TEGL_30950; TEGL_31000 Polar flagella ( Aeromonas ) fliP TEMA_40940 TEPE_11950 TEGL_11730 flmH - TEPE_06230 TEGL_05600 Type IV pili ( Neisseria ) pilT TEMA_31630 TEPE_02190 TEGL_02200 Regulation CheA/CheY ( Listeria ) cheY TEMA_41120...”
C6351_29520 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Bacillus thuringiensis
66% identity, 98% coverage
BC4365 Alcohol dehydrogenase from Bacillus cereus ATCC 14579
BC_4365 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Bacillus cereus ATCC 14579
65% identity, 98% coverage
- Methionine Sulfoxide Reductases Contribute to Anaerobic Fermentative Metabolism in Bacillus cereus
Duport, Antioxidants (Basel, Switzerland) 2021 - “...4.7 4.3 Degradative enzymes BC1991 TgC Putative murein endopeptidase 1/9 YKQS M DGTMQDIKK 3.3 Fermentation BC4365 AdhE bifunctional acetaldehyde-CoA alcohol dehydrogenase 4/30 QL M NHDGVALVLATGGAGMVK 3.2 M IDTLVNNGQQALQALESFTQEEIDNIVHEMALAGVDQHMPLAK 2.6 3.0 LPLISELKEIY M K 2.8 3.2 4.3 BC4870 Ldh2 L-lactate dehydrogenase 1/7 GI M DSGFDGIFLIATNPVDILTYVTWK 3.2 4.8...”
- Linking genome content to biofuel production yields: a meta-analysis of major catabolic pathways among select H2 and ethanol-producing bacteria
Carere, BMC microbiology 2012 - “...Geoth_3879 Geoth_0879 Geoth_0652 Geoth_1941 Geoth_2349 Geoth_3494 Geoth_0631 B. cereus ATCC 14579 BC5387 BC4637 BC2832 BC0802 BC4365 BC3555 BC2529 BC1285 BC2220 Abbreviations: pta , phosphotransacetylase; ack , acetate kinase; atk , acetate thiokinase; aldH , acetaldehyde dehydrogenase; adh , alcohol dehydrogenase; adhE ; bifunctional acetylaldehyde/alcohol dehydrogenase. Alternatively,...”
- Genome-Wide Investigation of Biofilm Formation in Bacillus cereus
Yan, Applied and environmental microbiology 2017 - “...626575 1003735 2059639 1875050 183948 2374525 1298318 BC_4365 BC_4755 BC_0382 BC_0221 BC_3875 BC_0685 BC_5070 BC143 1475960 BC150 BC157 2081676 1817740...”
- Proteomic evidences for rex regulation of metabolism in toxin-producing Bacillus cereus ATCC 14579
Laouami, PloS one 2014 - “...enzymes, such L-lactate dehydrogenases (Ldh; BC_1924, BC_4870, BC_4996), pyruvate formate lyase (PflB; BC_0491), alcohol dehydrogenase (BC_4365, BC_2220, BC_0802) and acetate kinase (BC_4634) were not significantly different in the mutant compared with wild-type cells. However, the lack of Rex resulted in a decrease of the abundance of...”
BA4599 aldehyde-alcohol dehydrogenase from Bacillus anthracis str. Ames
BAS4267 aldehyde-alcohol dehydrogenase from Bacillus anthracis str. Sterne
AW20_3928 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Bacillus anthracis str. Sterne
65% identity, 98% coverage
- Beyond the spore, the exosporium sugar anthrose impacts vegetative Bacillus anthracis gene regulation in cis and trans
Norris, Scientific reports 2023 - “...18 , 21 . A search of publicly available sequence records indicated B. anthracis strain Ba4599 Heroin, which was isolated from a European anthrax case linked to B. anthracis spore-contaminated heroin, had a novel SNP linked to the ant genotype. These three observations expanded the mechanisms...”
- “...(frameshift) FDAARGOS_694, London_493, London_494, London_498, London_499, London_500, London_501 UK (Senegal/Gambia) 2006 antB SNP G418T (stop) Ba4599 Heroin, UF00026, UF00430, A4566, A4568, A4606, 2000032945, 2000032955, 2002013072, 2002721572, 2000031055 Denmark, Norway, Scotland, United States, Turkey (heroin clade) 19572012 antC AAAAAAAG trip (stop) UF01063, UF01075 (WAG strains) Nigeria, Chad,...”
- Nucleotide polymorphism assay for the identification of west African group Bacillus anthracis: a lineage lacking anthrose
Zincke, BMC microbiology 2020 - “...anthracis strains in GenBank. Interestingly, a strain isolated from an injecting heroin user (str. Heroin Ba4599, accession no. AGQP01000002.1, https://www.ncbi.nlm.nih.gov/nuccore/AGQP01000002.1/ ) had a G/T substitution at position 418 of the antB gene resulting in a premature stop codon unobserved in the other genomes [ 24 ]....”
- “...the B-group isolated in Poland. Furthermore, a bioinformatics approach was used to genotype B. anthracis Ba4599 as Ant . Ba4599 caused an anthrax outbreak among heroin users in Europe associated with unusually high mortality (28.5%). Normally <2% mortality is seen in treated cutaneous infections [ 37...”
- Convergent evolution of diverse Bacillus anthracis outbreak strains toward altered surface oligosaccharides that modulate anthrax pathogenesis
Norris, PLoS biology 2020 - “...silent mutations indicated by asterisks found in anthrose-deficient WAG strains and in silico analysis of Ba4599. (C) Whole genome SNP phylogenetic trees representing the phylogenetic relationship of the anthrose-deficient strains to selected type strains in Anthracis lineages. Ant strains appear in blue type, and strain names...”
- “...identified a novel nonsense mutation SNP present in the anthrose biosynthetic gene antB of strain Ba4599 [ 50 ]. This strain was associated with an anthrax outbreak among injection heroin users in Europe [ 55 , 56 ] ( Fig 1B ). Additionally, we identified 2...”
- Current Status and Trends in Prophylaxis and Management of Anthrax Disease
Savransky, Pathogens (Basel, Switzerland) 2020 - “...diathesis [ 30 ]. Genetic analysis of the outbreak identified the strain as a novel Ba4599 phenotype [ 31 ]. Over 30% of patients contracting anthrax through IV drug use die [ 30 ]. Table 1 summarizes the major components of the different types of human...”
- Genotyping and phylogenetic location of one clinical isolate of Bacillus anthracis isolated from a human in Russia
Pisarenko, BMC microbiology 2019 - “...Earlier, Erin Price and co-authors [ 26 ] described the probable route of the Heroin Ba4599 strain, which caused a large outbreak of anthrax among heroin users, to European countries from the Central Asian region. From 227 to 240 SNPs distinguish the strain of this subcluster...”
- Comparison of French and Worldwide Bacillus anthracis Strains Favors a Recent, Post-Columbian Origin of the Predominant North-American Clade
Vergnaud, PloS one 2016 - “...(bioproject PRJNA54107), Australia_94 (bioproject PRJNA54137), Tsiankovskii-I (bioproject PRJNA54481), Carbosap (bioproject PRJNA224116, [ 23 ]), Heroin Ba4599 (bioproject PRJNA190302), UR-1 (bioproject PRJNA180871 [ 24 ]), BF-1 (bioproject PRJNA180907, [ 25 ]), Sen2Col2, Sen3, Gmb1 (bioprojects PRJEB1516, PRJEB1517, PRJEB1518, [ 26 ]), V770-NP1-R (bioproject PRJNA224116, [ 27 ]),...”
- “...from Turkey, and one from Ethiopia. The two strains isolated from drug users, UR-1 and Ba4599 [ 13 , 24 ], are very closely related but clearly distinct. UR-1 is characterized by a relatively long branch (178 SNPs) as compared to the Ba4599 terminal branch (15...”
- Whole Genome-Sequencing and Phylogenetic Analysis of a Historical Collection of Bacillus anthracis Strains from Danish Cattle
Derzelle, PloS one 2015 - “...Soviet Union A.Br 008/011 ABDN00000000.2 Ba3154 Bulgaria A.Br 008/011 ANFF00000000.1 Ba3166 Bulgaria A.Br 008/011 ANFG00000000.1 Ba4599 Scotland A.Br 008/011 AGQP00000000.1 UR-1 Germany A.Br 008/011 ALNY00000000.1 A0149 Turkey A.Br 008/011 SRX562299 Carbosap Italy A.Br 011/009 ANAO00000000.1 Sen2Col2 Africa A.Br 011/009 CAVC000000000.1 Sen3 Africa A.Br 011/009 CAVD000000000.1 Gmb1...”
- “...to discriminate both strains ( Fig 1 ). They were phylogenetically related to heroin-associated strains (Ba4599 and UR-1) isolated in 2009/2012 in Europe [ 10 , 23 ]. Outbreaks of injection anthrax in heroin users have been going on in Western Europe since at least the...”
- GcoGSA-BA: a global core genome SNP analysis for Bacillus anthracis
Yamashita, Health security 2015 - “...could be correctly assigned as closely related to the Ba4599 strain from the outbreak in 2009 originating from a Scottish heroin user, as well as the report...”
- More
- Beyond the spore, the exosporium sugar anthrose impacts vegetative Bacillus anthracis gene regulation in cis and trans
Norris, Scientific reports 2023 - “...Putative cation/acetate symporter 1.44 AW20_5667 Hypothetical protein; cytolysin domain upstream from cya, pXO1 1.45 AW20_3928 BAS4267 Acetaldehyde/alcohol dehydrogenase 1.46 AW20_3102 BAS5058 PTS system, cellobiose-specific IIC component 1.49 AW20_1735 BAS0950 Putative ring-cleaving dioxygenase MhqA 1.51 AW20_4872 BAS3352 Uncharacterized membrane protein YuiD -1.60 AW20_1801 BAS0887 Transcriptional regulator, TetR...”
- Changes in Bacillus anthracis CodY regulation under host-specific environmental factor deprived conditions
Kim, BMC genomics 2016 - “...(34F2 -Bic and 34F2 -Glu )] or all of the conditions ( e.g. , BAS0253, BAS4267, and BAS5155). Approximately one-third of the genes differentially expressed in 34F2 under starvation encoded hypothetical proteins with unknown domains (34F2 -Fe 7/36; 34F2 -Bic 11/28; 34F2 -Glu 19/71). Two hypothetical...”
- Beyond the spore, the exosporium sugar anthrose impacts vegetative Bacillus anthracis gene regulation in cis and trans
Norris, Scientific reports 2023 - “...BAS1518 Putative cation/acetate symporter 1.44 AW20_5667 Hypothetical protein; cytolysin domain upstream from cya, pXO1 1.45 AW20_3928 BAS4267 Acetaldehyde/alcohol dehydrogenase 1.46 AW20_3102 BAS5058 PTS system, cellobiose-specific IIC component 1.49 AW20_1735 BAS0950 Putative ring-cleaving dioxygenase MhqA 1.51 AW20_4872 BAS3352 Uncharacterized membrane protein YuiD -1.60 AW20_1801 BAS0887 Transcriptional regulator,...”
TEMA_20190 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Terrisporobacter mayombei
64% identity, 98% coverage
- Genome-based metabolic and phylogenomic analysis of three Terrisporobacter species
Böer, PloS one 2023 - “...TEMA_19280 TEPE_30830 TEGL_29820 GroEL groEL TEMA_27370 TEPE_39970 TEGL_38350 Listeria adhesion protein ( Listeria ) lap TEMA_20190; TEMA_20240 TEPE_31700; TEPE_31750 TEGL_30950; TEGL_31000 Polar flagella ( Aeromonas ) fliP TEMA_40940 TEPE_11950 TEGL_11730 flmH - TEPE_06230 TEGL_05600 Type IV pili ( Neisseria ) pilT TEMA_31630 TEPE_02190 TEGL_02200 Regulation CheA/CheY...”
TEGL_30950 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Terrisporobacter glycolicus ATCC 14880 = DSM 1288
64% identity, 98% coverage
- Genome-based metabolic and phylogenomic analysis of three Terrisporobacter species
Böer, PloS one 2023 - “...groEL TEMA_27370 TEPE_39970 TEGL_38350 Listeria adhesion protein ( Listeria ) lap TEMA_20190; TEMA_20240 TEPE_31700; TEPE_31750 TEGL_30950; TEGL_31000 Polar flagella ( Aeromonas ) fliP TEMA_40940 TEPE_11950 TEGL_11730 flmH - TEPE_06230 TEGL_05600 Type IV pili ( Neisseria ) pilT TEMA_31630 TEPE_02190 TEGL_02200 Regulation CheA/CheY ( Listeria ) cheY...”
Ethha_1385 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Ethanoligenens harbinense YUAN-3
62% identity, 97% coverage
A0A1D3TRQ6 acetaldehyde dehydrogenase (acetylating) (EC 1.2.1.10) from Anaerobium acetethylicum (see paper)
62% identity, 97% coverage
LMRG_01332 alcohol dehydrogenase, iron-containing from Listeria monocytogenes 10403S
61% identity, 98% coverage
- The redox-responsive transcriptional regulator Rex represses fermentative metabolism and is required for Listeria monocytogenes pathogenesis
Halsey, PLoS pathogens 2021 - “...RNA-seq results. 10.1371/journal.ppat.1009379.t001 Table 1 Rex-repressed genes-of-interest. 10403S EGD-e Gene Function Fold change in rex LMRG_01332 lmo1634 lap bifunctional acetaldehyde-CoA/alcohol dehydrogenase 342.30 LMRG_00859 lmo1407 pflC pyruvate formate-lyase 1-activating enzyme 88.30 LMRG_00858 lmo1406 pflB formate acetyltransferase 59.84 LMRG_00046 lmo0355 frdA fumarate reductase flavoprotein subunit 85.24 LMRG_01064 lmo1917...”
- “...etc. This information will give more insight into the impact of Rex. The lap gene (LMRG_01332, lmo1634) found in this study as Rex-dependent (342-fold; Tables 1 and S1) is probably one of most abundant in expression even in WT bacteria. Wurtzel et al (2012) showed its...”
- Alternative σ Factors Regulate Overlapping as Well as Distinct Stress Response and Metabolic Functions in Listeria monocytogenes under Stationary Phase Stress Condition
Orsi, Pathogens (Basel, Switzerland) 2021 - “...suggest epistatic interactions among alternative factors, but that did not meet our predefined criteria, included LMRG_01332 ( lmo1634 ), which encodes for an alcohol acetaldehyde dehydrogenase known as the Listeria adhesion protein, LAP [ 57 , 58 ]. This gene presented an FC = 54.1 in...”
- Home Alone: Elimination of All but One Alternative Sigma Factor in Listeria monocytogenes Allows Prediction of New Roles for σB
Liu, Frontiers in microbiology 2017 - “...transporter permease; and (iii) LMRG_01595, which encodes an MFS transporter permease. Other downregulated genes include LMRG_01332, which encodes Listeria adhesion protein (Lap), an alcohol acetaldehyde dehydrogenase involved in pathogenesis (Jagadeesan et al., 2010 ); LMRG_00198, encoding a phosphoglycerate mutase; LMRG_01596, encoding a shikimate 5-dehydrogenase, and LMRG_01597...”
- Transcriptomic Analysis of the Adaptation of Listeria monocytogenes to Growth on Vacuum-Packed Cold Smoked Salmon
Tang, Applied and environmental microbiology 2015 - “...LMRG_01480 6 86 2,589,714 490,907 LMOh7858_1751 lmo1634 LMRG_01332 7 8 2,504,749 1,849,977 LMOh7858_2605 lmo2456 (gpmI) LMRG_01792 8 12 2,229,167 1,648,039...”
NP_465159 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Listeria monocytogenes EGD-e
lmo1634 similar to Alcohol-acetaldehyde dehydrogenase from Listeria monocytogenes EGD-e
LM6179_2386 adhesion-mediating acetaldehyde/alcohol dehydrogenase LAP from Listeria monocytogenes 6179
61% identity, 98% coverage
- Functional genomic insights into Floricoccus penangensis ML061-4 isolated from leaf surface of Assam tea
Rungsirivanich, Scientific reports 2025 - “...183,518183,732 80 3e-18 WP_002376666 VFG006717 lap Listeria adhesion protein Lap Adherence 1,998,874- 1,998,938 90 3e-12 NP_465159 VFG000077 clpP ATP-dependent Clp protease proteolytic subunit Stress survival 290,069290,161 86 3e-12 NP_465991 VFG001855 htpB Hsp60, 60K heat shock protein HtpB Adherence 1,720,195- 1,720,355 81 3e-12 WP_197535493 VFG001967 glf UDP-galactopyranose...”
- First Report on the Finding of Listeria mnocytogenes ST121 Strain in a Dolphin Brain
Sévellec, Pathogens (Basel, Switzerland) 2020 - “...0/0 367 99.62 100.00 NP_464816 (oatA) peptidoglycan O-acetyltransferase lap 1-2601/2601 =============== 0/0 324 99.92 100.00 NP_465159 (lap) Listeria adhesion protein Lap lapB 1-5136/5136 =============== 0/0 329 99.10 100.00 NP_465191 (lapB) Listeria adhesion protein LapB inlC 1-891/891 =============== 0/0 362 99.89 100.00 NP_465311 (inlC) internalin C fbpA...”
- LAP, an alcohol acetaldehyde dehydrogenase enzyme in Listeria, promotes bacterial adhesion to enterocyte-like Caco-2 cells only in pathogenic species.
Jagadeesan, Microbiology (Reading, England) 2010 (PubMed)- GeneRIF: Alcohol acetaldehyde dehydrogenase (lmo1634) promotes bacterial adhesion to enterocyte.
- Addition of lime juice and NaCl to minced seafood may stimulate the expression of Listeria monocytogenes virulence, adhesion, and stress response genes
Hosseini, Food science & nutrition 2024 - “...Reverse primer (53) 16s GATGCATAGCCGACCTGAGA CTCCGTCAGACTTTCGTCCA hly TACATTAGTGGAAAGATGG ACATTCAAGCTATTATTTACA Plc CTAGAAGCAGGAATACGGTACA ATTGAGTAATCGTTTCTAAT inlA TGTTACAAGAACCTACGGCACCAACAA TTGGCGCTATATTGGGCATATAAGGTGATG lmo1634 GTTGTTGCCGGCGTTACAC CGCGATAATTGCTTTGAAAAGA lmo1847 GCGTGGATCCGCATGAAT GCATCCGCAGCACTTTGAAT sigB CCAAGAAAATGGCGATCAAGAC CGTTGCATCATATCTTCTAATAGCT 2.6 RNA extraction, purification, and quality control The total RNA of inoculated L . monocytogenes cells (>7 log CFU/g or ml) in...”
- Inactivation of lmo0946 (sif) induces the SOS response and MGEs mobilization and silences the general stress response and virulence program in Listeria monocytogenes
Ładziak, Frontiers in microbiology 2023 - “...the mobilome of L. monocytogenes. The most highly down-regulated gene in the lmo0946* mutant was lmo1634 . It encodes the Listeria adhesion protein (LAP), a putative bifunctional acetaldehyde-CoA/alcohol dehydrogenase involved in pyruvate metabolism. Three pyruvate-formate lyase encoding genes were found to be downregulated as well (...”
- “...inlA and inlB ( Milohanic et al., 2003 ). Additionally, the most highly downregulated gene, lmo1634 , encodes the LAP protein that promotes bacterial translocation across the intestinal epithelial barrier ( Drolia et al., 2018 ). Furthermore, among the highly downregulated genes were arpJ and pplA...”
- Petri-plate, bacteria, and laser optical scattering sensor
Bhunia, Frontiers in cellular and infection microbiology 2022 - “...Wiedmann, 2016 ) using Listeria species-specific PCR assays. PCR assay amplified a housekeeping gene ( lmo1634 ) encoding acetaldehyde alcohol dehydrogenase (AdhE), also known as Listeria adhesion protein (LAP) ( Drolia etal., 2018 ). Both PCR and BARDOT were complementary in their abilities to detect Listeria...”
- SecA2 Associates with Translating Ribosomes and Contributes to the Secretion of Potent IFN-β Inducing RNAs
Teubner, International journal of molecular sciences 2022 - “...beta subunit Transcription 0.05 0.06 lmo1003 ptsI Phosphoenolpyruvate-protein phosphotransferase Carbohydrate transport and metabolism 0.05 0.06 lmo1634 * lap Aldehyde-alcohol dehydrogenase Energy production and conversion 0.05 0.06 lmo0259 * rpoC DNA-directed RNA polymerase subunit beta Transcription 0.05 0.05 lmo1504 alaS AlaninetRNA ligase Translation 0.04 0.05 lmo2019 ileS...”
- A Whole Genome Sequencing-Based Epidemiological Investigation of a Pregnancy-Related Invasive Listeriosis Case in Central Italy
Russini, Pathogens (Basel, Switzerland) 2022 - “...(lmo1821) 5 inlJ (lmo2821) 172 svpA (lmo2185) 10 inlK (lmo1290) 14 tagB (lmo1088) 8 lap (lmo1634) 13 vip (lmo0320) 50 lapB (lmo1666) 11 virR (lmo1745) 4 lgt (lmo2482) 6 virS (lmo1741) 6 * New allele found. pathogens-11-00667-t002_Table 2 Table 2 Food and environmental samples collected for...”
- Alternative σ Factors Regulate Overlapping as Well as Distinct Stress Response and Metabolic Functions in Listeria monocytogenes under Stationary Phase Stress Condition
Orsi, Pathogens (Basel, Switzerland) 2021 - “...interactions among alternative factors, but that did not meet our predefined criteria, included LMRG_01332 ( lmo1634 ), which encodes for an alcohol acetaldehyde dehydrogenase known as the Listeria adhesion protein, LAP [ 57 , 58 ]. This gene presented an FC = 54.1 in the mutant...”
- “...and fine-tuning of the expression of specific pts genes [ 48 ]. Among those genes, lmo1634 encodes the Listeria adhesion protein (LAP), which has been shown to play a role in L. monocytogenes virulence by promoting paracellular translocation of the bacterial pathogen through intestinal epithelial cell...”
- Systematic identification of a panel of strong promoter regions from Listeria monocytogenes for fine-tuning gene expression
Ji, Microbial cell factories 2021 - “...promoter regions Gene id Name No. Description Length (bp) TPM (28 C) TPM (37 C) lmo1634 lmo1634 1 Bifunctional acetaldehyde-CoA/alcohol dehydrogenase 501 63189.35 50511.48 lmo2637 lmo2637 2 Hypothetical protein 447 36304.9 46430.03 lmo2459 gap 3 Glyceraldehyde-3-phosphate dehydrogenase 441 33735.74 18075.69 lmo2653 tuf 4 Elongation factor Tu...”
- Anaerobic Growth of Listeria monocytogenes on Rhamnose Is Stimulated by Vitamin B12 and Bacterial Microcompartment-Dependent 1,2-Propanediol Utilization
Zeng, mSphere 2021 - “...suggests four putative candidates annotated as alcohol dehydrogenase in L. monocytogenes EGDe, including lmo1166, lmo1171, lmo1634, and lmo1737, detected in the proteomes of both pdu -noninduced and pdu -induced cells (for details see Text S1 in the supplemental material). Since the discovery of the role of...”
- More
- The transcriptome of Listeria monocytogenes during co-cultivation with cheese rind bacteria suggests adaptation by induction of ethanolamine and 1,2-propanediol catabolism pathway genes
Anast, PloS one 2020 - “...life-cycle of L . monocytogenes has yet to be elucidated. The Listeria adhesion protein (LAP, LM6179_2386, Lmo1634), was significantly upregulated in all co-cultivation conditions save for co-cultivation with Brevibacterium S111 for two h in broth and 24 h on plates where very few or no DE...”
LMOf2365_1656 aldehyde-alcohol dehydrogenase from Listeria monocytogenes str. 4b F2365
61% identity, 98% coverage
Q6Q3I2 Aldehyde-alcohol dehydrogenase from Listeria monocytogenes
61% identity, 98% coverage
- Physical Features of Intracellular Proteins that Moonlight on the Cell Surface
Amblee, PloS one 2015 - “...Enteamoeba histolytica Q24803 [ 20 ] Alcohol acetaldehyde dehydrogenase Listeria adhesion protein (LAP) Listeria monocytogenes Q6Q3I2 [ 21 24 ] Aspartate ammonia lyase plasminogen binding Haemophilus influenzae P44324 [ 25 ] Alcohol dehydrogenase (ADH1) plasminogen binding Candida albicans P43067 [ 26 ] Bile salt hydrolase plasminogen...”
MONOS_10289 bifunctional acetaldehyde-CoA/alcohol dehydrogenase (adhE) from Monocercomonoides exilis
63% identity, 96% coverage
EQB38_RS01120 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Enterococcus faecium
58% identity, 99% coverage
OG1RF_10627 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Enterococcus faecalis OG1RF
57% identity, 99% coverage
Q837E3 Aldehyde-alcohol dehydrogenase from Enterococcus faecalis (strain ATCC 700802 / V583)
EF0900 aldehyde-alcohol dehydrogenase from Enterococcus faecalis V583
57% identity, 98% coverage
- Adaptation to cold and proteomic responses of the psychrotrophic biopreservative Lactococcus piscium strain CNCM I-4031
Garnier, Applied and environmental microbiology 2010 (secret) - Implications of the expression of Enterococcus faecalis citrate fermentation genes during infection
Martino, PloS one 2018 - “...acK , EF1983, pyruvate formate lyase ( pflB , EF1613), alcohol dehydrogenase ( adhE , EF0900) were repressed ( Fig 1C ). The up-regulation of citrate and some enzymes of pyruvate metabolism favor the proton consuming reactions and also contribute to increase the Acetyl-CoA pool that...”
- Transcription factor Rex in regulation of pathophysiology in oral pathogens
Bitoun, Molecular oral microbiology 2016 - “...pyruvate-formate lyase ( EF1613 ), pyruvate-formate lyase activating enzyme ( EF1612 ), alcohol/aldehyde dehydrogenase ( EF0900 ), anaerobic ribonucleotide reductase ( EF2754-5 ), and fumarate reductase ( EF1226-7 ) In addition, genes encoding abortive infection protein (EF2637) and cell envelope-associated acid phosphatse were also up-regulated in...”
- The Intraperitoneal Transcriptome of the Opportunistic Pathogen Enterococcus faecalis in Mice
Muller, PloS one 2015 - “...is strongly repressed in vivo (-48.7-fold). Furthermore, the gene encoding the bi-functional aldehyde-alcool dehydrogenase ( ef0900 ) catalysing the reduction of acetylCoA to ethanol, has a significantly induced expression (+11.7-fold). Therefore, acetylCoA seems to be mainly (if not exclusively) converted to ethanol under peritonitis infection conditions....”
- Whole-genome mapping of 5' RNA ends in bacteria by tagged sequencing: a comprehensive view in Enterococcus faecalis
Innocenti, RNA (New York, N.Y.) 2015 - “...exclusively catalyzed by Ldh-1, but also by Als (Ef1213), Pdh (Ef1353/Ef1354), Pfl (Ef1612/Ef1613), and AdhE (Ef0900), ending in the production of various products (acetate, ethanol, formate), and regenerate NAD+ from NADH ( Winstedt et al. 2000 ; Yamamoto et al. 2006 ; Pedersen et al. 2008...”
- Using a genome-scale metabolic model of Enterococcus faecalis V583 to assess amino acid uptake and its impact on central metabolism
Veith, Applied and environmental microbiology 2015 - “...ldh (EF0255, lactate dehydrogenase 1), adhE (EF0900, alcohol dehydrogenase), and pflAB (EF1612, pyruvate formate lyase-activating enzyme; EF1613, pyruvate...”
- A Rex family transcriptional repressor influences H2O2 accumulation by Enterococcus faecalis
Vesić, Journal of bacteriology 2013 - “...annotation EF0094 EF0255 EF0475 EF0634 EF0635 EF0900 Formate/nitrite transporter family protein L-Lactate dehydrogenase (EC 1.1.1.27) Ferrous iron transport...”
- “...activating enzyme (EF1612), alcohol/ aldehyde dehydrogenase (EF0900), anaerobic ribonucleotide reductase (EF2754-5), subunits of a putative fumarate reductase...”
- Growth rate-dependent control in Enterococcus faecalis: effects on the transcriptome and proteome, and strong regulation of lactate dehydrogenase
Mehmeti, Applied and environmental microbiology 2012 - “...product 0.05/0.15 0.4/0.15 EF0255 EF1612 EF0082 EF1964 EF0900 ldh-1 pflA Lactate dehydrogenase Pyruvate formate lyase-activating enzyme Major facilitator family...”
- “...(EF1964), bifunctional acetaldehyde-coenzyme A (CoA)/alcohol dehydrogenase (EF0900), and the principal lactate dehydrogenase (ldh-1; EF0255). As shown in Table...”
- Transcriptome, proteome, and metabolite analyses of a lactate dehydrogenase-negative mutant of Enterococcus faecalis V583
Mehmeti, Applied and environmental microbiology 2011 - “...real-time quantitative reverse transcription-PCR (qRT-PCR): EF0900 (adhE; bifunctional acetaldehyde-CoA/alcohol dehydrogenase gene), EF1612 (pflA; pyruvate...”
- “...February 11, 2017 by University of California, Berkeley EF0900 EF1612 EF0082 EF1964 EF0255 23S rRNA Reference Forward 2408 MEHMETI ET AL. APPL. ENVIRON....”
- More
W903_RS00440 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Streptococcus agalactiae CNCTC 10/84
56% identity, 96% coverage
- Nitric Oxide Production and Effects in Group B Streptococcus Chorioamnionitis
Keith, Pathogens (Basel, Switzerland) 2022 - “...A909, was a bifunctional acetaldehyde-CoA/alcohol dehydrogenase (A909 gene locus SAK_RS00425 and CNCTC 10/84 gene locus W903_RS00440) ( Table 1 ). There were 13 shared genes with at least a four-fold decrease in expression ( Table 2 ), of which six were classified as ABC transporters in...”
- “...(Serotype V) Gene Locus PANTHER Consensus Gene Annotation A909 LFC 10/84 LFC Mean LFC SAK_RS00425 W903_RS00440 alcohol dehydrogenase 4.43 3.32 3.87 SAK_RS00805 W903_RS00840 disulfide oxidoreductase 3.56 2.84 3.20 SAK_RS10680 W903_RS10090 hypothetical protein 3.48 2.60 3.04 SAK_RS03085 W903_RS03140 hypothetical protein 3.58 2.28 2.93 SAK_RS10170 W903_RS09695 pyruvate formate-lyase-activating...”
gbs0053 Unknown from Streptococcus agalactiae NEM316
SAG0053 aldehyde-alcohol dehydrogenase from Streptococcus agalactiae 2603V/R
SAK_RS00425 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Streptococcus agalactiae
56% identity, 96% coverage
- NAD+ pool depletion as a signal for the Rex regulon involved in Streptococcus agalactiae virulence
Franza, PLoS pathogens 2021 - “...regions were PCR amplified with primer pairs for the following genes gbs0023 ( purC ), gbs0053 ( adhE ), gbs0609 (nuclease-like), gbs1167 ( rex ), gbs1789 ( menA ), gbs1388 ( cyl ), gbs0110 , gbs1529 and gbs1929 ( cdnP ) ( S1 Table ). PCR...”
- Analysis of growth-phase regulated genes in Streptococcus agalactiae by global transcript profiling
Sitkiewicz, BMC microbiology 2009 - “...TGACAAGGATGTCA 65156 65169 92 gbs0049 ruvB Holliday junction DNA helicase ruvB TTAAAGCGCTTTCA 69320 69333 92 gbs0053 adh2 Alcohol dehydrogenase TGTAAACGATTACA 72238 72251 100 gbs0054 adhA Alcohol dehydrogenase TGGGAACGGTTTCA 130310 130323 92 gbs0119 ABC transporter permease protein TGTAATCGCTTACT 130334 130347 92 gbs0119 ABC transporter permease protein TATTAACGTTAACA...”
- Adaptive response of Group B streptococcus to high glucose conditions: new insights on the CovRS regulation network
Di, PloS one 2013 - “...for proteins required for fermentation processes were also found to be down-regulated, including sag1637 , sag0053 and sag0054 , annotated as alcohol dehydrogenases ( adh , adhP , adhE) . The down-regulation of genes codifying for proteins implicated in the biosynthesis and degradation of polysaccharides such...”
- Nitric Oxide Production and Effects in Group B Streptococcus Chorioamnionitis
Keith, Pathogens (Basel, Switzerland) 2022 - “...DETA, in both CNCTC 10/84 and A909, was a bifunctional acetaldehyde-CoA/alcohol dehydrogenase (A909 gene locus SAK_RS00425 and CNCTC 10/84 gene locus W903_RS00440) ( Table 1 ). There were 13 shared genes with at least a four-fold decrease in expression ( Table 2 ), of which six...”
- “...10/84 (Serotype V) Gene Locus PANTHER Consensus Gene Annotation A909 LFC 10/84 LFC Mean LFC SAK_RS00425 W903_RS00440 alcohol dehydrogenase 4.43 3.32 3.87 SAK_RS00805 W903_RS00840 disulfide oxidoreductase 3.56 2.84 3.20 SAK_RS10680 W903_RS10090 hypothetical protein 3.48 2.60 3.04 SAK_RS03085 W903_RS03140 hypothetical protein 3.58 2.28 2.93 SAK_RS10170 W903_RS09695 pyruvate...”
CHF17_RS00440 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Streptococcus agalactiae
56% identity, 96% coverage
M5005_Spy_0039 alcohol dehydrogenase/acetaldehyde dehydrogenase (acetylating) from Streptococcus pyogenes MGAS5005
56% identity, 96% coverage
SpyM3_0036 putative alcohol dehydrogenase II from Streptococcus pyogenes MGAS315
56% identity, 96% coverage
- Adhesin competence repressor (AdcR) from Streptococcus pyogenes controls adaptive responses to zinc limitation and contributes to virulence
Sanson, Nucleic acids research 2015 - “...responses ( 37 39 ). Further, the genes encoding alcohol dehydrogenases ( adh ) ( spyM3_0036 and spyM3_0037 ) were significantly upregulated in the adcR strain (Supplementary Table S4). This is contrary to the observations made in pneumococci in which both the genes were downregulated in...”
- “..., 40 ). The GAS genome has three genes encoding adh isozymes ( spyM3_0772 , spyM3_0036 and spyM3_0037 ), among which only the spyM3_0772 is annotated as zinc-containing ADH. The adh2 gene ( spyM3_0036 ) encodes a putative iron-containing ADH. Although adh1 is a zinc-dependent ADH,...”
A3CK27 Aldehyde-alcohol dehydrogenase from Streptococcus sanguinis (strain SK36)
SSA_0068 Alcohol-acetaldehyde dehydrogenase, putative from Streptococcus sanguinis SK36
56% identity, 96% coverage
- Environmental influences on Streptococcus sanguinis membrane vesicle biogenesis
Helliwell, The ISME journal 2023 - “...SSA_0860 A3CKQ4 SSA_0302 A3CM69 A3CQ69 SSA_1949 SSA_0847 A3CK27 SSA_0068 A3CL46 A3CKD3 SSA_0176 SSA_0453 A3CK77 SSA_0120 A3CKL7 A3CMA7 SSA_0886 A3CLV0 A3CLS0...”
- Conserved Streptococcus pneumoniae spirosomes suggest a single type of transformation pilus in competence
Laurenceau, PLoS pathogens 2015 - “...formation [ 19 26 ]. Accession Organism Identity Similarity Q8DNA5 Streptococcus pneumoniae (+) 100% 100% A3CK27 Streptococcus sanguinis (+) 96% 98% F8CW95 Geobacillus thermoglucosidasius (+) 58% 75% Q03B11 Lactobacillus casei (+) 55% 72% M5AAG2 Lactobacillus brevis (+) 54% 71% P0A9Q7 Escherichia coli (-) 48% 66% N1K5R4...”
- Environmental influences on Streptococcus sanguinis membrane vesicle biogenesis
Helliwell, The ISME journal 2023 - “...to host cells including adhesins (FusA, SSA_2109; AdhE, SSA_0068; Fba SSA_1992) and fibronectin- and plasminogen-binding proteins K R O X C SSA_1961 SSA_2153...”
- “...A3CKQ4 SSA_0302 A3CM69 A3CQ69 SSA_1949 SSA_0847 A3CK27 SSA_0068 A3CL46 A3CKD3 SSA_0176 SSA_0453 A3CK77 SSA_0120 A3CKL7 A3CMA7 SSA_0886 A3CLV0 A3CLS0 SSA_0688...”
- Glucose Phosphotransferase System Modulates Pyruvate Metabolism, Bacterial Fitness, and Microbial Ecology in Oral Streptococci
Zeng, Journal of bacteriology 2023 (secret) - Heterologous expression of sahH reveals that biofilm formation is autoinducer-2-independent in Streptococcus sanguinis but is associated with an intact activated methionine cycle
Redanz, The Journal of biological chemistry 2012 - “...3.7 3.44 3.19 3.88 4.41 Down-regulated SSA_0068 SSA_0220 adhE/alcohol-acetaldehyde dehydrogenase, putative PTS system, mannose-specific IIB component, putative...”
SGO_0113 alcohol-acetaldehyde dehydrogenase from Streptococcus gordonii str. Challis substr. CH1
56% identity, 96% coverage
Q8DNA5 Aldehyde-alcohol dehydrogenase from Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
spr1837 Alcohol-acetaldehyde dehydrogenase from Streptococcus pneumoniae R6
56% identity, 96% coverage
- Conserved Streptococcus pneumoniae spirosomes suggest a single type of transformation pilus in competence
Laurenceau, PLoS pathogens 2015 - “...Gram-negative (-) species with confirmed spirosome formation [ 19 26 ]. Accession Organism Identity Similarity Q8DNA5 Streptococcus pneumoniae (+) 100% 100% A3CK27 Streptococcus sanguinis (+) 96% 98% F8CW95 Geobacillus thermoglucosidasius (+) 58% 75% Q03B11 Lactobacillus casei (+) 55% 72% M5AAG2 Lactobacillus brevis (+) 54% 71% P0A9Q7...”
- Penicillin induces alterations in glutamine metabolism in Streptococcus pneumoniae
El, Scientific reports 2017 - “...operon transcriptional repressor 1.28 spr1722 groEL molecular chaperone GroEL 1.49 spr1800 hypothetical protein 1.00 1.00 spr1837 adhE bifunctional acetaldehyde-CoA/alcohol dehydrogenase 2.56 2.43 2.57 2.28 3.05 3.45 spr1866 adh zinc-containing alcohol dehydrogenase 1.03 1.06 spr1875 hypothetical protein 1.71 2.45 spr1895 pstS phosphate ABC transporter substrate+B766-binding protein 1.24...”
- “...protein 1.00 1.22 1.22 spr1801 ABC-NBD ABC transporter ATP-binding protein 1.22 spr1810 hypothetical protein 1.22 spr1837 adhE bifunctional acetaldehyde-CoA/alcohol dehydrogenase 2.20 2.27 2.15 3.07 3.09 spr1866 adh zinc-containing alcohol dehydrogenase 1.23 1.45 spr1895 pstS phosphate ABC transporter substrate+B766-binding protein 1.25 1.43 spr1896 pstC phosphate ABC transporter...”
- Regulation of iron transport in Streptococcus pneumoniae by RitR, an orphan response regulator
Ulijasz, Journal of bacteriology 2004 - “...spr0914 spr1108 spr0750 spr0114 spr1201 spr1527 spr0563 spr0294 spr1837 8130 ULIJASZ ET AL. FIG. 4. Northern blot analysis of ritR and neighboring genes. The...”
ADHE_STRP2 / A0A0H2ZM56 Aldehyde-alcohol dehydrogenase; EC 1.1.1.1; EC 1.2.1.3 from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
SPD_1834 alcohol dehydrogenase, iron-containing from Streptococcus pneumoniae D39
56% identity, 96% coverage
- function: Has alcohol dehydrogenase activity (PubMed:25312953). Has aldehyde dehydrogenase activity (By similarity). Plays a role in enhancing virulence in mice, under ethanol stress conditions, perhaps by inducing expression of pneumolysin (Ply) and increasing production of hydrogen peroxide H(2)O(2) (PubMed:25312953). May be considered a potential virulence factor (PubMed:25312953).
catalytic activity: an aldehyde + NAD(+) + H2O = a carboxylate + NADH + 2 H(+) (RHEA:16185)
catalytic activity: ethanol + NAD(+) = acetaldehyde + NADH + H(+) (RHEA:25290)
cofactor: Fe(2+)
disruption phenotype: Disruption mutant produces significantly less acetaldehyde and NADH after ethanol treatment (PubMed:25312953). Significantly lower H(2)O(2) levels after ethanol treatment (PubMed:25312953). Decreases intracellular pneumolysin Ply level, but no effect on choline binding protein CbpA, surface adhesin A PsaA, or pyruvate oxidase SpxB (PubMed:25312953). Mutant releases 1.59-fold lower level of Ply into culture supernatant (PubMed:25312953). Significantly lower hemolytic activity in vitro (PubMed:25312953). Attenuates virulence in CD-1 / ICR strain mouse intranasal infection model (PubMed:25312953). Significantly decreases cytokine levels, e.g. TNF, IL1B and IL6, and reduces inflammation, in mice infected intranasally (PubMed:25312953). - Comparative Metabolic Pathways Analysis and Subtractive Genomics Profiling to Prioritize Potential Drug Targets Against Streptococcus pneumoniae
Khan, Frontiers in microbiology 2021 - “...with neighbor proteins as SPD_0131 (Conserved hypothetical protein), SPD_0182 (Conserved hypothetical protein), SPD_0072 (Catechol 2,3-dioxygenase), SPD_1834 (Acetaldehyde dehydrogenase), TrmE (Trna modification gtpase trme), glyA (Glycine hydroxymethyltransferase), PolA (In addition to polymerase activity), prfA (Peptide chain release factor 1), tdk (Thymidine kinase), SPD_0905 (Acetyltransferase), SPD_0908 (L-threonylcarbamoyladenylate synthase),...”
- Pivotal Roles for Ribonucleases in Streptococcus pneumoniae Pathogenesis
Sinha, mBio 2021 - “...2.11 7.19E07 SPD_SR83 recG , spd_1506 3.90 4.12E20 SPD_SR95 dinF , lytA 2.44 4.17E05 SPD_SR101 spd_1834 , spd_1833 1.81 7.93E03 a RNA extraction and sRNA-seq analyses were performed as described in Materials and Methods. RNA was prepared from cultures of the encapsulated parent strain IU1781 (wild-type...”
- S1 Domain RNA-Binding Protein CvfD Is a New Posttranscriptional Regulator That Mediates Cold Sensitivity, Phosphate Transport, and Virulence in Streptococcus pneumoniae D39
Sinha, Journal of bacteriology 2020 (secret) - Redefining the Small Regulatory RNA Transcriptome in Streptococcus pneumoniae Serotype 2 Strain D39
Sinha, Journal of bacteriology 2019 - “...() () () () () () () () spd_1834, spd_1833 spd_1892, rrsD spd_1894, rrsD mutS, spd_1902 TSS position Genetic context(s) (classification) 3=/intergenic 1073074...”
- NADH-Mediated Gene Expression in Streptococcus pneumoniae and Role of Rex as a Transcriptional Repressor of the Rex-Regulon
Afzal, Frontiers in microbiology 2018 - “...Gap 2.7 spd_1824 Hypothetical protein 2.2 spd_1826 Nicotinate-nucleotide pyrophosphorylase, NadC 4.1 spd_1827 Hypothetical protein 3.2 spd_1834 Alcohol dehydrogenase, iron-containing, AdhE 1.7 spd_1864 Hypothetical protein 1.8 spd_1865 Alcohol dehydrogenase, zinc-containing, AdhB2 1.5 spd_1874 LysM domain protein 2.4 Downregulated genes spd_0113 Hypothetical protein 4.6 spd_0114 Hypothetical protein 5.3...”
- “...NadE 1.6 spd_1251 Nicotinate phosphoribosyltransferase, putative, PncB 2.0 spd_1823 Glyceraldehyde-3-phosphate dehydrogenase, type I, Gap 1.6 spd_1834 Alcohol dehydrogenase, iron-containing, AdhE 3.6 spd_1865 Alcohol dehydrogenase, zinc-containing, AdhB2 1.7 a Gene numbers refer to D39 locus tags. b D39 annotation ( Lanie et al., 2007 ), c Ratio...”
- Arachidonic Acid Stress Impacts Pneumococcal Fatty Acid Homeostasis
Eijkelkamp, Frontiers in microbiology 2018 - “...with AA also resulted in the up-regulation of multiple alcohol dehydrogenases (ADHs) including SPD_1636 (3.0-fold), SPD_1834 (4.4-fold) and SPD_1865 (4.7-fold). To examine the basis for this, the cellular ethanol abundance of untreated and AA-treated cells was assessed, revealing 2-fold higher ethanol accumulation in AA-treated cells by...”
- Niacin-mediated Gene Expression and Role of NiaR as a Transcriptional Repressor of niaX, nadC, and pnuC in Streptococcus pneumoniae
Afzal, Frontiers in cellular and infection microbiology 2017 - “...spd_1826 Nicotinate-nucleotide pyrophosphorylase, NadC 4.4 spd_1827 Hypothetical protein 3.1 spd_1833 PTS system, IIA component 1.7 spd_1834 Alcohol dehydrogenase, iron-containing, AdhE 5.8 spd_1865 Alcohol dehydrogenase, zinc-containing, AdhB2 1.7 spd_1874 LysM domain protein 3.7 DOWNREGULATED GENES spd_0113 Hypothetical protein 2.9 spd_0114 Hypothetical protein 3.1 spd_0115 Hypothetical protein 2.7...”
- Autoinducer 2 Signaling via the Phosphotransferase FruA Drives Galactose Utilization by Streptococcus pneumoniae, Resulting in Hypervirulence
Trappetti, mBio 2017 - “...SPD_1649 piuA Iron compound ABC transporter 1.6 2.0 1.6 SPD_1650 Iron compound ABC transporter 1.5 SPD_1834 adhE Bifunctional acetaldehyde-coenzyme A/alcohol dehydrogenase 2.0 0.1 0.1 SPD_1956 ilvD Dihydroxy-acid dehydratase 0.6 SPD_2012 glpO Alpha-glycerophosphate oxidase 1.7 SPD_2013 glpK Glycerol kinase 1.6 a Differential gene expression was determined by...”
- More
Spaf_0058 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Streptococcus parasanguinis FW213
56% identity, 96% coverage
ADHE_STRPN / A0A0H2URT2 Aldehyde-alcohol dehydrogenase; EC 1.1.1.1; EC 1.2.1.3 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
SPCG_RS10500, SP_RS10245 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Streptococcus pneumoniae CGSP14
SP_2026 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Streptococcus pneumoniae TIGR4
56% identity, 96% coverage
- function: Has alcohol dehydrogenase activity (By similarity). Has aldehyde dehydrogenase activity (By similarity). May play a role in enhancing virulence in mice. May be considered a potential virulence factor (By similarity).
catalytic activity: ethanol + NAD(+) = acetaldehyde + NADH + H(+) (RHEA:25290)
catalytic activity: an aldehyde + NAD(+) + H2O = a carboxylate + NADH + 2 H(+) (RHEA:16185)
cofactor: Fe(2+)
disruption phenotype: Reduction of 29.3%, in total NAD(H) pool, and 11.1% increase in the NAD+/NADH ratio (PubMed:36928033). Significant, but modest, reduction in the ATP pool, and extends lag phase during growth (PubMed:36928033). Increases susceptibility to gentamicin, but not erythromycin, chloramphenicol, rifampicin, penicillin and vancomycin (PubMed:36928033). Reduces production of the bacterial capsule (PubMed:36928033). Simultaneous disruption of alcohol dehydrogense adh resulted in similar growth rate, ATP level, and survival rate after erythromycin exposure (PubMed:36928033). - Streptococcus pneumoniae metal homeostasis alters cellular metabolism
Burcham, Metallomics : integrated biometal science 2020 - “...substrate-binding protein 2.0 NanE SP_RS08325 N-acetylmannosamine-6-phosphate-2-epimerase 1.4 RaiA SP_RS11265 ribosomal subunit interface protein 1.3 AdhE SP_RS10245 alcohol dehydrogenase (iron) 4.8 RpiA SP_RS04050 ribose-5-phosphate isomerase A CodY 3.3 PiuA SP_RS09285 iron ABC-transporter 1.3 GapN SP_RS05545 glyceraldehyde-3-phosphate dehydrogenase ArgR 1.7 ArcB SP_RS10960 ornithine carbamoyltransferase 5.3 ArtM SP_RS04030 ABC-type...”
- The transcriptomic response of Streptococcus pneumoniae following exposure to cigarette smoke extract
Manna, Scientific reports 2018 - “...Membrane protein 2.23 0.005 SPCG_RS09960 Hypothetical protein 2.80 0.006 SPCG_RS09965 DUF4231 domain-containing protein 2.20 0.048 SPCG_RS10500 Bifunctional acetaldehyde-CoA/alcohol dehydrogenase 1.91 0.024 SPCG_RS08740 Sodium ABC transporter permease 1.76 0.029 SPCG_RS04615 FtsX-like ABC transporter permease 1.67 0.007 SPCG_RS03430 Hypothetical protein 1.57 0.015 SPCG_RS11680 Chromosome partitioning protein ParB 1.54...”
- The Streptococcus pneumoniae transcriptome in patient cerebrospinal fluid identifies novel virulence factors required for meningitis
Wall, 2024 - Targeting NAD+ regeneration enhances antibiotic susceptibility of Streptococcus pneumoniae during invasive disease
Im, PLoS biology 2023 - “...with fomepizole, starkly enhances the susceptibility to erythromycin. We also observed that deletion of adhE (SP_2026) significantly influenced the NAD pool and amount of available ATP. Previously, Luong and colleagues reported that adhE deletion decreased the production of Spn choline-binding proteins and pneumolysin and was attenuating...”
- “...and builds on prior work that alcohol dehydrogenases are vital enzymes. Adh (SP_0285) and AdhE (SP_2026) share near identical binding sites for their substrates [ 42 , 43 ]. It is noteworthy that in follow-up experiments, a double knockout of adh/adhE behaved similarly to the adhE...”
- Anatomical Site-Specific Carbohydrate Availability Impacts Streptococcus pneumoniae Virulence and Fitness during Colonization and Disease
Im, Infection and immunity 2022 (secret)
D11S_1811 oxidoreductase domain protein from Aggregatibacter actinomycetemcomitans D11S-1
55% identity, 97% coverage
SSU0261 aldehyde-alcohol dehydrogenase [includes: alcohol dehydrogenase; acetaldehyde dehydrogenase] from Streptococcus suis P1/7
SSU98_0275 NAD-dependent aldehyde dehydrogenase from Streptococcus suis 98HAH33
B9H01_01465 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Streptococcus suis
56% identity, 96% coverage
- Isolation, Characterization and Biological Properties of Membrane Vesicles Produced by the Swine Pathogen Streptococcus suis
Haas, PloS one 2015 - “...C5VY00 SSU0115 Zinc-binding protein AdcA 56 kDa AdcA/Zinc-binding protein Unknown Redox (n = 1) C5VYT4 SSU0261 Aldehyde-alcohol dehydrogenase 97 kDa Oxydoreductase Unknown Uncharacterized proteins (n = 4) C5VV38 SSU0595 Putative exported protein 13 kDa Unknown C5VZS6 SSU1560 Putative lipoprotein 17 kDa Unknown C5VV37 SSU0594 Putative exported...”
- In vitro transcriptome analysis of two Chinese isolates of Streptococcus suis serotype 2
Zhang, Genomics, proteomics & bioinformatics 2014 - “...SSU98_0384 1.92 PTS IIC component, glucose 3.2.1.86 SSU98_2083 1.02 Alpha-galactosidase 1.1.1.1 SSU98_0274 1.63 AdhA 1.1.1.1 SSU98_0275 1.92 Bifunctional acetaldehyde-CoA 3.2.1.86 SSU98_1500 6.14 Beta-glucosidase 05ZYH33 2.7.1.69 SSU05_0398 1.56 PTS IIC component, glucose/maltose/ N -acetylglucosamine-specific 3.2.1.86 SSU05_2079 1.69 Alpha-galactosidase/6-phospho-beta-glucosidase 1.1.1.1 SSU05_0279 2.29 Alcohol dehydrogenase 1.1.1.1 SSU05_0280 3.01 Bifunctional...”
- Comparative Phenotypic, Proteomic, and Phosphoproteomic Analysis Reveals Different Roles of Serine/Threonine Phosphatase and Kinase in the Growth, Cell Division, and Pathogenicity of Streptococcus suis
Hu, Microorganisms 2021 - “...five VFs were upregulated, including FeoB (B9H01_06805), PurD (B9H01_00260), GroEL (B9H01_00900), SLY (B9H01_06770), and AdhE (B9H01_01465), compared with those in the WT strain. These results corresponded with the virulence phenotype associated with the disruption of STK with significantly attenuated virulence of S. suis , while deletion...”
C4M230 Aldehyde-alcohol dehydrogenase from Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
EHI_150490 alcohol dehydrogenase, putative from Entamoeba histolytica HM-1:IMSS
54% identity, 98% coverage
- Unraveling the relevance of the polyadenylation factor EhCFIm25 in Entamoeba histolytica through proteomic analysis
Salgado-Martínez, FEBS open bio 2021 - “...DAVID. KEGG analyses evidenced that four of the proteins with a reduced abundance, C4LXE8, C4M192, C4M230, and C4LVD3, have an impact on at least five biochemical pathways. They also confirmed that reduced proteins are mainly related to metabolism, namely carbon metabolism, metabolic pathways, glycolysis/gluconeogenesis, and pyruvate...”
- “...EHI_051060 C4LTX6 XP_657019.2 PFOR 5.023063656 3.386220638 1.636843018 EHI_009530 Q24801 XP_657332.1 PK/PPDK 3.443328065 2.212267448 1.231060617 EHI_150490 C4M230 XP_652300.1 ADHE 3.338295165 2.276880037 1.061415128 EHI_125950 C4LVY0 XP_650419.1 Alcohol dehydrogenase_putative (ADH) 2.493758657 1.026187504 1.467571153 EHI_166490 C4M7F5 XP_652262.2 Alcohol dehydrogenase_putative (ADH) 1.048881287 1.286563624 0.237682337 EHI_198620 C4LWQ8 XP_655201.2 PPiPEPCK3 8.318126762 5.902664315 2.415462446...”
- Fumagillin inhibits growth of the enteric protozoan parasite Entamoeba histolytica by covalently binding to and selectively inhibiting methionine aminopeptidase 2
Watanabe, Antimicrobial agents and chemotherapy 2023 - “...10.883 0.94 Cluster of Elongation factor 1-alpha EHI_052400 48 kDa 10.277 9.5226 1.07 Aldehyde-alcohol dehydrogenase EHI_150490 96 kDa 10.277 6.8019 1.51 Elongation factor 1-alpha EHI_052400 48 kDa 9.4868 9.5226 0.99 Peroxiredoxin EHI_122310 27 kDa 9.4868 6.8019 1.39 a Normalized relative ratio coprecipitated with biotin-fumagillin/biotin linker. Overexpression...”
- EhVps23, an ESCRT-I Member, Is a Key Factor in Secretion, Motility, Phagocytosis and Tissue Invasion by Entamoeba histolytica
Galindo, Frontiers in cellular and infection microbiology 2022 - “...chain EHI_110180 Rho family GTPase EHI_129750 Phosphopyruvate hydratase EHI_130700 Calreticulin EHI_136160 EhRabC3 EHI_143650 Aldehyde-alcohol dehydrogenase EHI_150490 EhRabC1 EHI_153690 3-ketoacyl-CoA synthase EHI_158240 EhVps45A EHI_160900 90 kDa heat shock protein EHI_163480 Grainin 1 EHI_167300 EhRabX11 EHI_177520 Rho family GTPase EHI_181250 ATP-sulfurylase EHI_197160 70 kDa heat shock protein EHI_199590...”
- “...protein EHI_136150 Rab family GTPase EHI_143650 Thioredoxin domain-containing protein EHI_145840 Aspartate--ammonia ligase EHI_148470 Aldehyde-alcohol dehydrogenase EHI_150490 Flavodoxin-like domain-containing protein EHI_152650 Actin-related protein 2/3 complex subunit 4 EHI_152660 Uncharacterized protein EHI_161070 Aspartyl-tRNA synthetase EHI_175050 Profilin EHI_176140 EhRabX11 EHI_177520 Acetyl-CoA synthetase EHI_178960 Rho family GTPase EHI_181250 Actin EHI_182900...”
- Unraveling the relevance of the polyadenylation factor EhCFIm25 in Entamoeba histolytica through proteomic analysis
Salgado-Martínez, FEBS open bio 2021 - “...One group correspond proteins related to metabolism including glycolysis (EHI_00070, EHI_188180, EHI_130700, EHI_009530, 051060, EHI_178960, EHI_150490), 1433 proteins (EHI_098280, EHI_006810), among others, as well as heatshock proteins (EHI_199590, EHI_052860; EHI_196940); the other corresponds to cytoskeletal proteins (EHI_110180, EHI_111050, EHI_094060, EHI_154430, and EHI_199000), and the last one...”
- “...1.041316242 EHI_051060 C4LTX6 XP_657019.2 PFOR 5.023063656 3.386220638 1.636843018 EHI_009530 Q24801 XP_657332.1 PK/PPDK 3.443328065 2.212267448 1.231060617 EHI_150490 C4M230 XP_652300.1 ADHE 3.338295165 2.276880037 1.061415128 EHI_125950 C4LVY0 XP_650419.1 Alcohol dehydrogenase_putative (ADH) 2.493758657 1.026187504 1.467571153 EHI_166490 C4M7F5 XP_652262.2 Alcohol dehydrogenase_putative (ADH) 1.048881287 1.286563624 0.237682337 EHI_198620 C4LWQ8 XP_655201.2 PPiPEPCK3 8.318126762 5.902664315...”
- An Alcohol Dehydrogenase 3 (ADH3) from Entamoeba histolytica Is Involved in the Detoxification of Toxic Aldehydes
König, Microorganisms 2020 - “...three ADHs have homology to Zn-dependent type 1 ADHs. In AmoebaDB three genes are annotated (EHI_150490, EHI_160940, EHI_024240), which encode for a bifunctional EhADH2 with homology to ADHE of Escherichia coli . EHI_150490 and EHI_160940 encoding for an EhADH2 which consists of 870 amino acids (99%...”
- “...the first 787 amino acids can be used for a sequence comparison of EHI_024240 with EHI_150490 and EHI_160940. This indicates a sequence identity of 97%, because of a 14 amino acid deletion of EHI_024240 ( Table 1 and Table 2 ). Beside the already described EhADH3...”
- Identification of S-Nitrosylated (SNO) Proteins in Entamoeba histolytica Adapted to Nitrosative Stress: Insights into the Role of SNO Actin and In vitro Virulence
Trebicz-Geffen, Frontiers in cellular and infection microbiology 2017 - “...dehydrogenase in NAT. In contrast, five alcohol dehydrogenase including the bifunctional aldehyde-alcohol dehydrogenase 2 (ADH2) (EHI_150490) were identified in TEANS (Hertz et al., 2014a ). ADH2 (EHI_150490) is essential for the parasite (Espinosa et al., 2001 ) and it catalyzes the formation of ethanol and the...”
- Proteome analysis of excretory-secretory proteins of Entamoeba histolytica HM1:IMSS via LC-ESI-MS/MS and LC-MALDI-TOF/TOF
Ujang, Clinical proteomics 2016 - “...Name 10lgP Matched peptides Sequence coverage (%) Top ten proteins identified through LCESI MS/MS 1 EHI_150490 Aldehyde-alcohol dehydrogenase 2 putative 149.46 56 73 2 EHI_051060 Pyruvate:ferredoxin oxidoreductase 148.56 50 53 3 EHI_009530 Pyruvate phosphate dikinase 146.95 47 60 4 EHI_006980 Gal/GalNAc lectin subunit Igl1 135.22 35...”
- “...Top ten proteins identified through LCMALDI TOF/TOF EHI_160940 Aldehyde-alcohol dehydrogenase 2, putative 28.67 17 31.8 EHI_150490 Aldehyde-alcohol dehydrogenase 2 28.67 17 31.8 EHI_130700 Enolase, putative 25.52 13 53.2 EHI_009530 Pyruvate phosphate dikinase 20.16 8 30.9 EHI_044970 Malic enzyme, putative 11.96 5 30.4 EHI_178960 Acetyl-CoA synthetase, putative...”
- Gene expression profiling in Entamoeba histolytica identifies key components in iron uptake and metabolism
Hernández-Cuevas, PloS one 2014 - “...XM_645327 NM 3.9 3.6 Alcohol dehydrogenase ADH3 EHI_160670 XM_001914165 NM 3.7 NM Alcohol dehydrogenase ADH2 EHI_150490 XM_647208 NM 2.5 NM Alcohol dehydrogenase ADH3 EHI_088020 XM_643978 NM 4.2 2.8 Aldehyde-alcohol dehydrogenase ADH2 EHI_160940 XM_650725 NM 2.2 NM Aldehyde-alcohol dehydrogenase ADH2 EHI_024240 XM_001913618 NM 2.3 NM Aldose reductase...”
- Host-Parasite interactions in Entamoeba histolytica and Entamoeba dispar: what have we learned from their genomes?
Wilson, Parasite immunology 2012 - “...inflammatory response, although no definite role in virulence was determined ( 54 ). ADH2 (EHI_024240, EHI_150490 and EHI_160940) was more highly expressed in HM-1:IMSS than in E. dispar ( 54 ). ADH2 is associated with the cell membrane and is involved in iron scavenging from the...”
- More
ADH2_ENTH1 / Q24803 Aldehyde-alcohol dehydrogenase 2; EC 1.1.1.1; EC 1.2.1.10 from Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM) (see 2 papers)
EHI_160940 alcohol dehydrogenase, putative from Entamoeba histolytica HM-1:IMSS
54% identity, 98% coverage
- function: This enzyme has two NAD(+)-dependent activities: ADH and ACDH. May be a critical enzyme in the fermentative pathway.
catalytic activity: a primary alcohol + NAD(+) = an aldehyde + NADH + H(+) (RHEA:10736)
catalytic activity: a secondary alcohol + NAD(+) = a ketone + NADH + H(+) (RHEA:10740)
catalytic activity: acetaldehyde + NAD(+) + CoA = acetyl-CoA + NADH + H(+) (RHEA:23288)
cofactor: Zn(2+) Fe(2+) (Zinc or iron.)
subunit: Seems to form a rod shaped homomer composed of at least 20 identical subunits. - Glycerol biosynthetic pathway plays an essential role in proliferation and antioxidative defense in the human enteric protozoan parasite Entamoeba histolytica
Jeelani, Scientific reports 2023 - “...(EHI_032470), peroxiredoxin (EHI_139570), Rab family GTPase (EHI_187090), elongation factor 2 (EHI_166810, EHI_164510), aldehyde-alcohol dehydrogenase 2 (EHI_160940) and others genes were upregulated (Supplementary Dataset 2 ). Interestingly we found that glycerol kinase (EHI_164850) which is related to glycerol pathway was up-regulated by 30.7 fold (Supplementary Dataset 2...”
- “...one of the crucial enzymes in the fermentation pathway, aldehyde-alcohol dehydrogenase 2 (EhADH2 or EhADHE, EHI_160940), was>threefold upregulated (Supplementary Dataset 2 ). EhADH2 is a bifunctional enzyme with both aldehyde dehydrogenase and alcohol dehydrogenase activities, both of which are depended on NADH 33 . It is...”
- An Alcohol Dehydrogenase 3 (ADH3) from Entamoeba histolytica Is Involved in the Detoxification of Toxic Aldehydes
König, Microorganisms 2020 - “...ADHs have homology to Zn-dependent type 1 ADHs. In AmoebaDB three genes are annotated (EHI_150490, EHI_160940, EHI_024240), which encode for a bifunctional EhADH2 with homology to ADHE of Escherichia coli . EHI_150490 and EHI_160940 encoding for an EhADH2 which consists of 870 amino acids (99% identity)....”
- “...787 amino acids can be used for a sequence comparison of EHI_024240 with EHI_150490 and EHI_160940. This indicates a sequence identity of 97%, because of a 14 amino acid deletion of EHI_024240 ( Table 1 and Table 2 ). Beside the already described EhADH3 coding genes...”
- Horizontal Gene Transfers from Bacteria to Entamoeba Complex: A Strategy for Dating Events along Species Divergence
Romero, Journal of parasitology research 2016 - “...the candidates with the largest gene families, hypothetical protein and aldehyde-alcohol dehydrogenase 2 (EHI_104900 and EHI_160940, resp.), were discarded after the substitution saturation tests. It is likely that these gene families are result of an ancient HGT and have lost phylogenetic information, due to mutational saturation;...”
- Proteome analysis of excretory-secretory proteins of Entamoeba histolytica HM1:IMSS via LC-ESI-MS/MS and LC-MALDI-TOF/TOF
Ujang, Clinical proteomics 2016 - “...Description Score (%) Matched peptides Sequence coverage (%) Top ten proteins identified through LCMALDI TOF/TOF EHI_160940 Aldehyde-alcohol dehydrogenase 2, putative 28.67 17 31.8 EHI_150490 Aldehyde-alcohol dehydrogenase 2 28.67 17 31.8 EHI_130700 Enolase, putative 25.52 13 53.2 EHI_009530 Pyruvate phosphate dikinase 20.16 8 30.9 EHI_044970 Malic enzyme,...”
- Gene expression profiling in Entamoeba histolytica identifies key components in iron uptake and metabolism
Hernández-Cuevas, PloS one 2014 - “...XM_647208 NM 2.5 NM Alcohol dehydrogenase ADH3 EHI_088020 XM_643978 NM 4.2 2.8 Aldehyde-alcohol dehydrogenase ADH2 EHI_160940 XM_650725 NM 2.2 NM Aldehyde-alcohol dehydrogenase ADH2 EHI_024240 XM_001913618 NM 2.3 NM Aldose reductase NADPH-dependent oxidoreductase EHI_157010 XM_001914421 NM 5.6 NM Aldose reductase NADPH-dependent oxidoreductase EHI_039190 XM_648674 NM 5.1 NM...”
- Host-Parasite interactions in Entamoeba histolytica and Entamoeba dispar: what have we learned from their genomes?
Wilson, Parasite immunology 2012 - “...although no definite role in virulence was determined ( 54 ). ADH2 (EHI_024240, EHI_150490 and EHI_160940) was more highly expressed in HM-1:IMSS than in E. dispar ( 54 ). ADH2 is associated with the cell membrane and is involved in iron scavenging from the host's transferrin...”
- Endoplasmic reticulum stress-sensing mechanism is activated in Entamoeba histolytica upon treatment with nitric oxide
Santi-Rocca, PloS one 2012 - “...5.5E-05 EHI_024240 aldehyde-alcohol dehydrogenase ADH2 4.0 2.5E-04 5.9E-07 EHI_161010 glyceraldehyde-3-phosphate dehydrogenase GAPDH 3.5 3.5E-04 1.9E-06 EHI_160940 aldehyde-alcohol dehydrogenase ADH2 3.5 2.4E-04 4.5E-07 EHI_150490 aldehyde-alcohol dehydrogenase ADH2 3.2 3.7E-04 2.1E-06 EHI_050940 2,3-bisphosphoglycerate mutase iPGAM 3.1 2.7E-04 8.2E-07 EHI_009530 pyruvate phosphate dikinase PPDK 3.0 5.6E-05 4.7E-09 EHI_198760 alcohol...”
- Physical Features of Intracellular Proteins that Moonlight on the Cell Surface.
Amblee, PloS one 2015 - “...Species UniProt Reference Alcohol acetaldenyde dehydrogenase fibronectin, laminin, and type II collagen binding Enteamoeba histolytica Q24803 [ 20 ] Alcohol acetaldehyde dehydrogenase Listeria adhesion protein (LAP) Listeria monocytogenes Q6Q3I2 [ 21 24 ] Aspartate ammonia lyase plasminogen binding Haemophilus influenzae P44324 [ 25 ] Alcohol dehydrogenase...”
- The ald gene, encoding a coenzyme A-acylating aldehyde dehydrogenase, distinguishes Clostridium beijerinckii and two other solvent-producing clostridia from Clostridium acetobutylicum
Toth, Applied and environmental microbiology 1999 - “...dehydrogenases of E. coli (P17547), Entamoeba histolytica (Q24803 and S53319), C. acetobutylicum (P33744 and A49346), Lactococcus lactis (CAA04467), and Giardia...”
- “...14.7 Conserved region Accession no. L06902 AAA80209 Q24803 U93353 P38947 P33744 P17547 CAA04467 P11883 a Abbreviations: Aad, AdhE, and Adh2, aldehyde-alcohol...”
adh2 / GB|AAA81906.1 aldehyde-alcohol dehydrogenase 2; EC 1.1.1.1; EC 1.2.1.10 from Entamoeba histolytica (see paper)
AAA81906.1 alcohol dehydrogenase 2 from Entamoeba histolytica (see paper)
54% identity, 98% coverage
SSU05_0280 NAD-dependent aldehyde dehydrogenase from Streptococcus suis 05ZYH33
56% identity, 97% coverage
- The Redox-Sensing Regulator Rex Contributes to the Virulence and Oxidative Stress Response of Streptococcus suis Serotype 2
Zhu, Frontiers in cellular and infection microbiology 2018 - “...Adenylosuccinate lyase 0.37 0.59 0.03 NT SSU05_1128 A4VVF5 pepT Peptidase T 0.59 0.62 0.11 NT SSU05_0280 A0A0Z8JA13 adhE Aldehyde-alcohol dehydrogenase 2.01 7.35 0.37 Shift SSU05_0624 A4VU01 arcA Arginine deiminase 1.79 2.55 0.15 Shift SSU05_2153 A0A0H3MXX6 frdA Fumarate reductase flavoprotein subunit 7.59 6.10 0.34 Shift SSU05_0279 A4VT08...”
- The Eukaryote-Like Serine/Threonine Kinase STK Regulates the Growth and Metabolism of Zoonotic Streptococcus suis
Zhang, Frontiers in cellular and infection microbiology 2017 - “...glycolysis were significantly down-regulated, including ptsG (SSU05_0397), crr (SSU05_0398), pgk (SSU05_0157), adhA (SSU05_0279), and adhE (SSU05_0280) (Figure 4 ). Notably, expression levels of rpsN (SSU05_1535), rpsR (SSU05_1832), rpsP (SSU05_0796), rpsU (SSU05_1433), and glyS (SSU05_1764) translation-associated genes in the pathways of ribosome and aminoacyl-tRNA biosynthesis were decreased...”
- “...chain C ClpC 5.68 down 9.79E-56 clpE SSU05_0390 ATP-dependent protease ClpE 11.12 down 2.26E-95 adhE SSU05_0280 acetaldehyde dehydrogenase Lap 4.02 down 0 purD SSU05_0033 Phosphoribosylamine-glycine ligase Metabolism 3.87 down 0 purA SSU05_1966 Adenylosuccinate synthase Metabolism 2.15 down 0 manN SSU05_1779 Mannose-specific PTS Metabolism 3.89 down 0...”
- The roles of RelA/(p)ppGpp in glucose-starvation induced adaptive response in the zoonotic Streptococcus suis
Zhang, Scientific reports 2016 - “...genes encoding enzymes associated with alcohol utilization were also up-regulated, including adhA (SSU05_0279) and adhE (SSU05_0280). The arcABC operon (SSU05_0624, SSU05_0626, SSU05_0627) encoding the arginine deiminase system (ADS) was significantly up-regulated in both SC-19 and relA , and the fold change of this operon in SC-19...”
- In vitro transcriptome analysis of two Chinese isolates of Streptococcus suis serotype 2
Zhang, Genomics, proteomics & bioinformatics 2014 - “...IIC component, glucose/maltose/ N -acetylglucosamine-specific 3.2.1.86 SSU05_2079 1.69 Alpha-galactosidase/6-phospho-beta-glucosidase 1.1.1.1 SSU05_0279 2.29 Alcohol dehydrogenase 1.1.1.1 SSU05_0280 3.01 Bifunctional acetaldehyde-CoA/alcohol dehydrogenase 3.2.1.86 SSU05_1489 5.05 Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase Note: FC stands for fold change, which was calculated by log 2 expression of the respective Chinese isolate/expression of P1/7. PTS, phosphotransferase...”
- Effect of licochalcone A on growth and properties of Streptococcus suis
Hao, PloS one 2013 - “...SSU05_0083 GGCTTCCGTCTTCGTGAG AAGTGAAACTGTAACCAATTTGTC SSU05_0085 TTGCCTGCTGGTGTTGAG GTTTGGACGGTGAAGAGTTAC SSU05_0087 ACAATCCCTCACGAAGTTC AAGTCACATCTGCGATACC SSU05_0089 GTGGTACATCATCAGGTAACG GGAAGACGACGGAACAATG SSU05_0279 GCTACTCTGTTGACGGTGGTATG AGTAACGCCAGCACAAGTGATAG SSU05_0280 TGTCACCTGTTATTGCCGTCTTG TTCTGCGTCTTCCGTATGAATAGC SSU05_0479 AGTGCTGGCGTCAAAGATGG TGAAGAAGGTTGGCAGGTAATCC SSU05_1759 ACTATACGAAGGCTGAACCAATC CTACGAGCATAGAGCACTAAGG References 1 Gottschalk M , Segura M , Xu J ( 2007 ) Streptococcus suis infections in humans: the Chinese experience and...”
I872_00255 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Streptococcus cristatus AS 1.3089
54% identity, 96% coverage
- Redox-Regulated Adaptation of Streptococcus oligofermentans to Hydrogen Peroxide Stress
Tong, mSystems 2020 - “...100 0.5 0.5 100* 4 I872_06890 Pyruvate kinase AICEETGNGHVQLFAK C235 100 0 57.4 24.9* 5 I872_00255 Aldehyde-alcohol dehydrogenase IAEPVGVVCGITPTTNPTSTAIFK C120 100 0 100* 6 I872_10355 6-Phospho-beta-glucosidase NVETCLAQPVLLR C318 100 0 100* 7 I872_00060 Hypoxanthine phosphoribosyltransferase NLCNLFK C112 100 0 100* 8 I872_01620 Protein translocase subunit SecA...”
SE0506 alcohol dehydrogenase from Staphylococcus epidermidis ATCC 12228
55% identity, 98% coverage
SERP_RS02070 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Staphylococcus epidermidis RP62A
SERP0389 alcohol dehydrogenase, iron-containing from Staphylococcus epidermidis RP62A
55% identity, 98% coverage
NPW32_RS04630 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Staphylococcus epidermidis
55% identity, 98% coverage
- The first genomic characterization of a stable, hemin-dependent small colony variant strain of Staphylococcus epidermidis isolated from a prosthetic-joint infection
Bogut, Frontiers in microbiology 2023 - “...deletion) Elastin-binding protein EbpS/staphylococcal binding to soluble elastin and tropoelastin NPW32_RS08970 cls2 178/494 Phosphatidylserine/phosphatidylglycerophosphate/cardiolipin synthase NPW32_RS04630 adhE 8/869 Bifunctional acetaldehyde-CoA/alcohol dehydrogenase NPW32_RS08460 152/316 Ornithine cyclodeaminase family protein +1A in poly(A), frameshift, premature stop codon NPW32_RS08320 vraC 105/120 Hypothetical VraC protein; vraC gene is linked to fatty...”
- “...premature stop codon (8aa/869aa) was identified in the adhE gene (synonymous gene name adhC ; NPW32_RS04630) encoding a hypothetical bifunctional acetaldehyde-CoA dehydrogenase and an iron-dependent alcohol dehydrogenase. The AdhE catalyzes the sequential reduction of acetyl-CoA to acetaldehyde and then to ethanol under fermentative conditions ( EcoCyc,...”
SAOUHSC_00113 alcohol dehydrogenase, iron-containing, putative from Staphylococcus aureus subsp. aureus NCTC 8325
Q2G1K9 Aldehyde-alcohol dehydrogenase from Staphylococcus aureus (strain NCTC 8325 / PS 47)
SAUSA300_0151 alcohol dehydrogenase, iron-containing from Staphylococcus aureus subsp. aureus USA300_FPR3757
SACOL0135 alcohol dehydrogenase, iron-containing from Staphylococcus aureus subsp. aureus COL
55% identity, 98% coverage
- Teg58, a small regulatory RNA, is involved in regulating arginine biosynthesis and biofilm formation in Staphylococcus aureus
Manna, Scientific reports 2022 - “...coiled-coil protein , srpF 2371 625 3.79 SAOUHSC_00299 Nucleoside recognition domain-containing protein 2492 10,462 4.2 SAOUHSC_00113 Acetaldehyde dehydrogenase, adhE 6858 25,673 3.74 SAOUHSC_00412 NADH dehydrogenase, subunit 5, ndhF 11,703 1775 6.59 SAOUHSC_00139 Acyl-CoA dehydrogenase 1066 341 3.13 SAOUHSC_00075 Siderophore staphylobactin biosynthesis protein, sbnA 92 21 4.41...”
- Copper stress in Staphylococcus aureus leads to adaptive changes in central carbon metabolism
Tarrant, Metallomics : integrated biometal science 2019 - “...SAOUHSC_00608 gi|122540071 0.3 <0.00010 Formate acetyltransferase pflB SAOUHSC_00187 gi|446817404 0.1 <0.00010 Bifunctional acetaldehyde-CoA/alcohol dehydrogenase adhE SAOUHSC_00113 gi|88193926 0.1 <0.00010 Leukocidin-like protein 2 lukH SAOUHSC_02243 gi|122539025 0.1 <0.00010 Leukocidin-like protein 1 lukG SAOUHSC_02241 gi|122539026 0.06 0.00014 Anaerobic ribonucleoside triphosphate reductase nrdD SAOUHSC_02942 gi|88196568 0.04 <0.00010 Phenol-soluble modulin...”
- Functional analysis of the EsaB component of the Staphylococcus aureus Type VII secretion system
Casabona, Microbiology (Reading, England) 2017 - “...3.2 SAOUHSC_01937 10.3 Unknown, hypothetical protein 2.8 SAOUHSC_02970 argR 8.8 Arginine repressor family protein ns SAOUHSC_00113 adhE 8.6 Bifunctional acetaldehyde-CoA/alcohol dehydrogenase ns SAOUHSC_00051 plc 8.1 1-phosphatidylinositol phosphodiesterase 2.5 SAOUHSC_00898 argH 6.7 Argininosuccinate lyase ns SAOUHSC_02684 nasD 6.6 Assimilatory nitrite reductase [NAD(P)H] large subunit ns SAOUHSC_02709 hlgC...”
- Alternative Evolutionary Pathways for Drug-Resistant Small Colony Variant Mutants in Staphylococcus aureus
Cao, mBio 2017 - “...d SCV vs WT a srrA vs SCV b srrB vs SCV c Pyruvate fermentation SAOUHSC_00113, adhE Alcohol dehydrogenase 2.1 3.2 3.3 1.6 SAOUHSC_00608, adh1 Alcohol dehydrogenase I 3.1 3.3 3.6 3.5 SAOUHSC_00206, ldh1 l -Lactate dehydrogenase 6.8 0.2 0.3 3.4 SAOUHSC_02922, ldh2 l -Lactate dehydrogenase...”
- A quinolinol-based small molecule with anti-MRSA activity that targets bacterial membrane and promotes fermentative metabolism
Nair, The Journal of antibiotics 2017 - “...( pflB , SAOUHSC_00187), lactate ( ldh , SAOUHSC_00206), and ethanol metabolism ( adh , SAOUHSC_00113). We observed a two-fold increase in the transcript level of both pflB and ldh vs. untreated control, but no significant change in adh upon treatment of actively growing USA300 with...”
- Coculture of Staphylococcus aureus with Pseudomonas aeruginosa Drives S. aureus towards Fermentative Metabolism and Reduced Viability in a Cystic Fibrosis Model
Filkins, Journal of bacteriology 2015 - “...SAOUHSC_00187), lactate (ldh, SAOUHSC_00206), and ethanol (adh, SAOUHSC_00113) fermentation pathways. S. aureus gene expression in coculture with P. aeruginosa...”
- “...dehydrogenase (ldh, SAOUHSC_00206), and alcohol dehydrogenase (adh, SAOUHSC_00113), all of which are associated with fermentation pathways in S. aureus (Fig....”
- The Staphylococcus aureus KdpDE two-component system couples extracellular K+ sensing and Agr signaling to infection programming
Xue, Infection and immunity 2011 - “...Berkeley Metabolism genes SAOUHSC_01389 SAOUHSC_00113 SAOUHSC_01619 SAOUHSC_01825 SAOUHSC_02281 SAOUHSC_02282 SAOUHSC_02283 SAOUHSC_02671 SAOUHSC_02679...”
- Redox sensing by a Rex-family repressor is involved in the regulation of anaerobic gene expression in Staphylococcus aureus
Pagels, Molecular microbiology 2010 - “...1.4 (1.2) 1 (1.6) 1.4 (0.8) 2.9 (2) SACOL1535 DNA-binding response regulator Class II proteins SAOUHSC_00113 AdhE + 1 13.4 (6.9) 48.1 (12.4) 7.9 (1.8) 6.1 (7.1) 1.7 (4) SACOL0135 Alcohol dehydrogenase, iron-containing 2 14.6 (12.3) 67.8 (17.8) 8.9 (2.8) 7.6 (6.4) 1.6 (4.4) SACOL0135 3...”
- A Small Membrane Stabilizing Protein Critical to the Pathogenicity of Staphylococcus aureus
Duggan, Infection and immunity 2020 - “...protein 2 2.9 <0.0001 Q2G1C8 Uncharacterized protein 3.0 <0.0001 Q2G1D0 Acetyl-coenzyme A acetyltransferase 4.4 0.003 Q2G1K9 Aldehyde-alcohol dehydrogenase 4.6 0.001 Q2FWP0 Uncharacterized leukocidin-like protein 1 4.9 0.003 Q2FVJ5 bioD ATP-dependent dethiobiotin synthetase BioD 6.3 0.001 Q2G218 ish1 l -Lactate dehydrogenase 1 7.3 0.001 Q2G091 ABC transporter...”
- A Novel Mechanism of Inactivating Antibacterial Nitro Compounds in the Human Pathogen Staphylococcus aureus by Overexpression of a NADH-Dependent Flavin Nitroreductase
El-Hossary, Antimicrobial agents and chemotherapy 2018 - “...SAUSA300_1988 SAUSA300_1058 SAUSA300_1974 SAUSA300_1975 SAUSA300_0151 SAUSA300_2154 SAUSA300_2153 SAUSA300_2155 SAUSA300_1992 SAUSA300_1991 SAUSA300_1989...”
- Virulence and Metabolism
Richardson, Microbiology spectrum 2019 (secret) - Identification of Staphylococcus aureus Cellular Pathways Affected by the Stilbenoid Lead Drug SK-03-92 Using a Microarray
Schwan, Antibiotics (Basel, Switzerland) 2017 - “...genes tied to a potential mechanism of action for SK-03-92 included glpD , adhE ( SACOL0135 ), adhP ( SACOL0660 ), and sdhC ( SACOL1158 ). GlpD funnels electrons into the respiratory chain via quinone or menaquinone reduction coupled to the oxidation of glycerol-3-phosphate to glycerone...”
- “...3.8 para-nitrobenzyl esterase ( pnbA ) SACOL1142 10.0 aerobic glyerol-3-phosphate dehydrogenase ( glpD ) Catabolism SACOL0135 2.4 alcohol dehydrogenase, iron-containing ( adhE ) SACOL0660 3.4 alcohol dehydrogenase, zinc-containing ( adhA ) SACOL1158 2.5 succinate dehydrogenase, cytochrome b558 subunit ( sdhC ) SACOL1604 2.1 glucokinase ( glk...”
- Staphylococcus aureus gene expression in a rat model of infective endocarditis
Hanses, Genome medicine 2014 - “...-6.1 ABC transporter, permease protein SACOL0160 -4.9 -7.1 -5.5 -7.9 conserved hypothetical protein Metabolism adhE SACOL0135 22.9 22.3 30.9 31.1 alcohol dehydrogenase, iron-containing ald SACOL1478 42.3 24.0 31.2 17.6 alanine dehydrogenase arcB1 SACOL1181 ns ns 2.2 2.5 ornithine carbamoyltransferase arcC SACOL1182 21.8 15.3 12.9 9.9 carbamate...”
- Changes in the Staphylococcus aureus transcriptome during early adaptation to the lung
Chaffin, PloS one 2012 - “...( figure 7B ). The only exceptions were modestly higher expression of alcohol dehydrogenase adhE (SACOL0135) and lactate dehydrogenase 1 ldh1 (SACOL0222) compared to stationary phase cells ( figure 7A ). The largest decreases in expression compared to stationary phase were seen in acsA1 (SACOL1783, acetyl-CoA...”
- Protecs, a comprehensive and powerful storage and analysis system for OMICS data, applied for profiling the anaerobiosis response of Staphylococcus aureus COL
Fuchs, Proteomics 2010 (PubMed)- “...by an induction of fermentation enzymes (PflB, Ldh1, SACOL0135, SACOL0660) as well as the response regulator SrrA. Interestingly, especially genes with a high...”
- “...GltA citrate malate AcnA acetolactate PflB Pta Acetyl-CoA SACOL0135 IlvB SACOL0241 BudA1 acetoin SACOL0660 ethanol SACOL0111 FumC Icd fumarate SdhA SdhB SdhC...”
- Redox sensing by a Rex-family repressor is involved in the regulation of anaerobic gene expression in Staphylococcus aureus
Pagels, Molecular microbiology 2010 - “...a Description a Pos b Rex binding motifs c EMSA d mRNA e Prot e SACOL0135 (adhE) Alcohol dehydrogenase, iron-containing 39 Shift Up Up SACOL0301 (nirC) Formate/nitrite transporter family protein 51 Shift SACOL1478 ald1 Alanine dehydrogenase 38 Shift Up SACOL0660 (adh1) Alcohol dehydrogenase 306 Shift Up...”
- “...proteins SAOUHSC_00113 AdhE + 1 13.4 (6.9) 48.1 (12.4) 7.9 (1.8) 6.1 (7.1) 1.7 (4) SACOL0135 Alcohol dehydrogenase, iron-containing 2 14.6 (12.3) 67.8 (17.8) 8.9 (2.8) 7.6 (6.4) 1.6 (4.4) SACOL0135 3 3.9 (3.4) 21.2 (5.3) 2.9 (0.6) 7.4 (9.1) 1.4 (5.7) SACOL0135 SAOUHSC_00187 PflB +...”
- A defect in menadione biosynthesis induces global changes in gene expression in Staphylococcus aureus
Kohler, Journal of bacteriology 2008 - “...Although the amounts of PflB, SACOL0660 (Adh1), and SACOL0135 (AdhE) were also slightly increased, the production of ethanol and acetate should be restricted,...”
- “...protein SrrA, response regulator; SACOL0135, alcohol dehydrogenase/acetaldehyde dehydrogenase; SACOL0301, formate/nitrite transporter; SACOL0660, alcohol...”
- Anaerobic gene expression in Staphylococcus aureus
Fuchs, Journal of bacteriology 2007 - “...NAD-dependent epimerase/ dehydratase family protein; SACOL0135, alcohol dehydrogenase; SACOL0301, formate/nitrite transporter protein; SACOL0660, alcohol...”
- “...and ethanol formation such as pflB and pflA and the SACOL0135 and SACOL0660 genes had high levels of transcription as well (Fig. 1C; see Table S1 in the...”
- More
ST398NM01_0162 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Staphylococcus aureus subsp. aureus 71193
SA0143 alcohol-acetaldehyde dehydrogenase from Staphylococcus aureus subsp. aureus N315
MW0123 alcohol-acetaldehyde dehydrogenase from Staphylococcus aureus subsp. aureus MW2
55% identity, 98% coverage
- Multi-omics revealed antibacterial mechanisms of licochalcone A against MRSA and its antimicrobic potential on pork meat
Zeng, Food chemistry: X 2024 - “...PflB Formate C -acetyltransferase 0.642 <0.001 SAKOR_01367 PBS lyase HEAT-like repeat protein SakoR 1.816 <0.001 ST398NM01_0162 Aldehyde-alcohol dehydrogenase 0.421 <0.001 E5491_12165 DUF1542 domain-containing protein 1.601 0.03 Lip2 Triacylglycerol lipase 3.228 <0.001 FPP09_01715 AAA family ATPase 1.612 0.003 ST398NM01_2664 Anaerobic ribonucleoside-triphosphate reductase 0.512 0.027 PurA Carbamate kinase...”
- Respiration and Small Colony Variants of Staphylococcus aureus
Proctor, Microbiology spectrum 2019 (secret) - Proteomic and Membrane Lipid Correlates of Reduced Host Defense Peptide
Kohler, Antibiotics (Basel, Switzerland) 2019 - “...under anaerobic conditions. Protein (Annotation From 315) Function Ratio log2 (SH1000/snoD) Increased in parent AdhE (SA0143) Acetaldehyde DH 1.46 (SA2367) Theoretical protein 1.044 Decreased in mutant DapE (SA1814) Lysine metabolism 1.021 (SA2366) Theoretical protein 1.051 AgrA (SA1844) Virulence regulator 1.287 Increased in mutant IlvA1 (SA1271) Threonine/serine...”
- Characterization of the oxygen-responsive NreABC regulon of Staphylococcus aureus
Schlag, Journal of bacteriology 2008 - “...with 2 mM nitrate Locus taga Upregulated genes SA0143 SA0183 SA0232 SA0477 SA0478 SA0562 SA0588 SA0589 SA1140 SA1149 SA1150 SA1183 SA1269 SA1270 SA1271 SA1506...”
- Insights into the mode of action of chitosan as an antibacterial compound
Raafat, Applied and environmental microbiology 2008 - “...SA0249 SA1023 Metabolism of carbohydrates and related molecules SA0143 SA0218 SA0219 Metabolism of amino acids and related molecules SA2189 Regulation of RNA...”
- Characterization of a strain of community-associated methicillin-resistant Staphylococcus aureus widely disseminated in the United States
Tenover, Journal of clinical microbiology 2006 - “...SA0136 SA0137 SA0138 SA0139 SA0140 SA0141 SA0142 SA0143 Capsular Capsular Capsular Capsular Capsular Capsular Capsular Capsular synthesis synthesis synthesis...”
- Global regulatory impact of ClpP protease of Staphylococcus aureus on regulons involved in virulence, oxidative stress response, autolysis, and DNA repair
Michel, Journal of bacteriology 2006 - “...2017 by University of California, Berkeley Down-regulated SA0143 SA0218-SA0219e SA0232 SA0293 SA0295 SA0562 SA0641 SA1272 SA1813 Gene name GLOBAL REGULATION OF...”
- Global regulation of Staphylococcus aureus genes by Rot
Saïd-Salim, Journal of bacteriology 2003 - “...downregulated by Rot N315 ORF no.b 4877 4218 1726 1664 SA1811 SA0143 SA0471 SA2312 904 1885 1434 1527 4046 5281 1928 1927 1700 4715 4583 5046 2268 3524 431 4537...”
- Balancing the Virulence and Antimicrobial Resistance in VISA DAP-R CA-MRSA Superbug
Salemi, Antibiotics (Basel, Switzerland) 2022 - “...diverse environments 12 17 6-phosphofructokinase (pfkA) MW1642 Acetate--CoA ligase (acsA) MW1676 Bifunctional acetaldehyde-CoA/alcohol dehydrogenase (adhE) MW0123 Glucose-6-phosphate isomerase (pgi) MW0844 Glucokinase (glcK) MW1499 Glyceraldehyde-3-phosphate dehydrogenase (gap) MW0734 Phosphoglycerate kinase (pgk) MW0735 Pyruvate kinase (pykA) MW1641 Triosephosphate isomerase (tpiA) MW0736 PTS system transporter subunit IIA (crr) MW1312...”
LSEI_0775 NAD-dependent alcohol-acetaldehyde dehydrogenase and iron-binding alcohol dehydrogenase from Lactobacillus casei ATCC 334
Q03B11 Aldehyde-alcohol dehydrogenase from Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
LSEI_0775 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Lacticaseibacillus paracasei ATCC 334
54% identity, 99% coverage
SAOV_0095 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Staphylococcus aureus subsp. aureus ED133
55% identity, 98% coverage
- Staphylococcus aureus seroproteomes discriminate ruminant isolates causing mild or severe mastitis
Le, Veterinary research 2011 - “...745,83 50,79 14 2,59 S C [ 82 ] bifunctional acetaldehyde-CoA/alcohol dehydrogenase 79 011_0796 046_0709 SAOV_0095 5,68 94945 2090,64 45,45 33 2,26 CW C D-3-phosphoglycerate dehydrogenase 100 011_0585 046_1131 SAOV_2344 5,32 34652 717,85 43,53 11 1,72 CW C atpD F0F1 ATP synthase subunit beta 62, 90...”
Q03U32 Aldehyde-alcohol dehydrogenase from Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
54% identity, 97% coverage
M5AAG2 Aldehyde-alcohol dehydrogenase from Levilactobacillus brevis KB290
54% identity, 95% coverage
SAR0150 putative aldehyde-alcohol dehydrogenase from Staphylococcus aureus subsp. aureus MRSA252
55% identity, 98% coverage
- The Staphylococcus aureus response to unsaturated long chain free fatty acids: survival mechanisms and virulence implications
Kenny, PloS one 2009 - “...8.71 4.16E-06 RNAIII RNAIII RNAIII accessory gene regulator ( agr ) locus 10.20 1.21E-05 Metabolism SAR0150 adhE putative aldehyde-alcohol dehydrogenase 2.25 1.67E-02 SAR0190 glcA glucose-specific PTS transporter protein, IIABC component 2.05 3.76E-02 SAR0829 pgk phosphoglycerate kinase 2.76 2.16E-03 SAR0830 tpiA triosephosphate isomerase 2.75 1.69E-03 SAR0831 pgm...”
- “...SAR2007 putative oxygenase/mitric oxide synthase 2.04 7.13E-03 SAR2007 putative nitric oxide synthase 2.66 2.38E-02 Metabolism SAR0150 adhE putative aldehyde-alcohol dehydrogenase 3.48 5.07E-03 SAR0246 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2.43 4.84E-04 SAR0246 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2.21 8.75E-03 SAR0564 putative haloacid dehalogenase-like hydrolase 2.22 1.01E-02 SAR1070 pdhD dihydrolipoamide...”
APL_1011 aldehyde-alcohol dehydrogenase 2 from Actinobacillus pleuropneumoniae L20
56% identity, 97% coverage
LGG_00757 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Lacticaseibacillus rhamnosus GG
LGG_00757 NAD-dependent alcohol-acetaldehyde dehydrogenase and iron-binding alcohol dehydrogenase from Lactobacillus rhamnosus GG
54% identity, 99% coverage
CBG46_02335 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Actinobacillus succinogenes
Asuc_0591 iron-containing alcohol dehydrogenase from Actinobacillus succinogenes 130Z
55% identity, 97% coverage
- Comparative Transcriptome Analysis Reveals the Molecular Mechanisms of Acetic Acid Reduction by Adding NaHSO<sub>3</sub> in <i>Actinobacillus succinogenes</i> GXAS137
Li, Polish journal of microbiology 2023 - “...+ -dependent decarboxylating) F: GCATCCGAGCAATTCGACT 187 R: GCCAATCCGCCATAGCATT CBG46_04725 ATPase F: TATCACTACATTGGCGGGCTA 181 R: AATTTGATTCAGCGTCCAGT CBG46_02335 bifunctional acetaldehyde-alcohol dehydrogenase F: CCAACACGGCACATTAGCAT 191 R: ATATCACGCCAACCGGATCG CBG46_03325 L-threonine dehydrogenase F: ATCGAAGCCTACGTATCCAC 197 R: ATCGCATGAACATAGCCGAGA CBG46_08215 ribose 5-phosphate isomerase B F: GAGCGTGGAATTCTTACCTG 160 R: CAATCACACGCTCACCGAA CBG46_05965 2-deoxyribose-5-phosphate aldolase F:...”
- “...SA synthesis pathway in EG and increased the yield of SA. The transcription level of CBG46_02335 involved in pyruvate metabolism increased by 1.41 log 2 FC and encoded acetaldehyde-alcohol dehydrogenase (EC.1.2.1.10). Depending on whether this gene was enriched in pyruvate metabolism, acetyl-coenzyme A (acetyl-CoA) was catalyzed...”
- A genomic perspective on the potential of Actinobacillus succinogenes for industrial succinate production
McKinlay, BMC genomics 2010 - “...Among them, Asuc_0403, 0591, 1136, and 1955 belong to the iron-containing alcohol dehydrogenase protein family. Asuc_0591 is a good candidate for ethanol production. It is probably a multifunctional aldehyde/alcohol dehydrogenase [ 37 ], and it is 47% identical (66% similar) to E. coli AdhE (GenBank accession...”
LSA0379 Bifunctional enzyme: alcohol dehydrogenase, acetaldehyde dehydrogenase from Lactobacillus sakei subsp. sakei 23K
55% identity, 98% coverage
LC20001_RS09775 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM
52% identity, 98% coverage
TCEL_01373, WP_018660634 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Thermobrachium celere DSM 8682
54% identity, 100% coverage
EHI_024240, XP_001913653 aldehyde-alcohol dehydrogenase 2, putative from Entamoeba histolytica HM-1:IMSS
54% identity, 100% coverage
- Entamoeba histolytica: EhADH, an Alix Protein, Participates in Several Virulence Events through Its Different Domains
Zanatta, International journal of molecular sciences 2024 - “...30 , 31 ] EHI_011210 Elongation factor 1-Alpha 1 Enzyme [ 30 , 31 ] EHI_024240 Aldehyde-alcohol dehydrogenase 2 Enzyme [ 22 , 57 ] EHI_051940 Poly (ADP-ribose) glucohydrolase Enzyme [ 30 , 31 ] EHI_152650 Flavoprotein type A Enzyme [ 30 , 31 ] EHI_044970...”
- Entamoeba histolytica Adaption to Auranofin: A Phenotypic and Multi-Omics Characterization
Shaulov, Antioxidants (Basel, Switzerland) 2021 - “...complex subunit 3); dehydrogenase (PC00092), such as NAD (FAD)-dependent dehydrogenase (EHI_099700) or Aldehyde-alcohol dehydrogenase 2 (EHI_024240); and guanyl-nucleotide exchange factor, such as Ras guanine nucleotide exchange factor (EHI_023270) or Rho guanine nucleotide exchange factor (EHI_005910) are significantly enriched according to the PANTHER statistical overrepresentation test (...”
- Queuine Is a Nutritional Regulator of Entamoeba histolytica Response to Oxidative Stress and a Virulence Attenuator
Nagaraja, mBio 2021 - “...RecQ family helicase (EHI_028890); oxidoreductase activity (GO:0016491) such as peroxiredoxin (EHI_145840) and aldehyde-alcohol dehydrogenase 2 (EHI_024240); catalytic activity, acting on RNA (GO:0140098) such as regulator of nonsense transcripts (EHI_035550) and RNA lariat debranching enzyme (EHI_062730); actin binding (GO:0003779) such as coronin (EHI_122800) and villidin (EHI_150430); cytoskeletal...”
- An Alcohol Dehydrogenase 3 (ADH3) from Entamoeba histolytica Is Involved in the Detoxification of Toxic Aldehydes
König, Microorganisms 2020 - “...have homology to Zn-dependent type 1 ADHs. In AmoebaDB three genes are annotated (EHI_150490, EHI_160940, EHI_024240), which encode for a bifunctional EhADH2 with homology to ADHE of Escherichia coli . EHI_150490 and EHI_160940 encoding for an EhADH2 which consists of 870 amino acids (99% identity). The...”
- “...Therefore, only the first 787 amino acids can be used for a sequence comparison of EHI_024240 with EHI_150490 and EHI_160940. This indicates a sequence identity of 97%, because of a 14 amino acid deletion of EHI_024240 ( Table 1 and Table 2 ). Beside the already...”
- Gene expression profiling in Entamoeba histolytica identifies key components in iron uptake and metabolism
Hernández-Cuevas, PloS one 2014 - “...XM_643978 NM 4.2 2.8 Aldehyde-alcohol dehydrogenase ADH2 EHI_160940 XM_650725 NM 2.2 NM Aldehyde-alcohol dehydrogenase ADH2 EHI_024240 XM_001913618 NM 2.3 NM Aldose reductase NADPH-dependent oxidoreductase EHI_157010 XM_001914421 NM 5.6 NM Aldose reductase NADPH-dependent oxidoreductase EHI_039190 XM_648674 NM 5.1 NM Aldose reductase NADPH-dependent oxidoreductase EHI_107560 XM_001914234 NM 5.0...”
- “...transcripts were upregulated in the iron deficiency + Hb condition; they included aldehyde-alcohol dehydrogenase 2 (EHI_024240; a 2.3-fold increase), which known to be involved in the internalization of human transferrin [47] and is regulated by iron [3] . Alcohol dehydrogenase (EHI_125950) and NADP-dependent alcohol dehydrogenase (EHI_023110)...”
- Host-Parasite interactions in Entamoeba histolytica and Entamoeba dispar: what have we learned from their genomes?
Wilson, Parasite immunology 2012 - “...host inflammatory response, although no definite role in virulence was determined ( 54 ). ADH2 (EHI_024240, EHI_150490 and EHI_160940) was more highly expressed in HM-1:IMSS than in E. dispar ( 54 ). ADH2 is associated with the cell membrane and is involved in iron scavenging from...”
- Endoplasmic reticulum stress-sensing mechanism is activated in Entamoeba histolytica upon treatment with nitric oxide
Santi-Rocca, PloS one 2012 - “...aldose reductase, NADPH-dependent oxidoreductase 5.9 3.8E-04 2.2E-06 EHI_039190 aldose reductase, NADPH-dependent oxidoreductase 5.4 2.0E-03 5.5E-05 EHI_024240 aldehyde-alcohol dehydrogenase ADH2 4.0 2.5E-04 5.9E-07 EHI_161010 glyceraldehyde-3-phosphate dehydrogenase GAPDH 3.5 3.5E-04 1.9E-06 EHI_160940 aldehyde-alcohol dehydrogenase ADH2 3.5 2.4E-04 4.5E-07 EHI_150490 aldehyde-alcohol dehydrogenase ADH2 3.2 3.7E-04 2.1E-06 EHI_050940 2,3-bisphosphoglycerate mutase...”
- Pyruvate:ferredoxin oxidoreductase and bifunctional aldehyde-alcohol dehydrogenase are essential for energy metabolism under oxidative stress in Entamoeba histolytica.
Pineda, The FEBS journal 2010 (PubMed)- GeneRIF: amebal PFOR and ALDH of EhADH2 activities as markers of oxidative stress, and outlined their relevance as significant controlling steps of energy metabolism in parasites subjected to oxidative stress
Ccar_07995 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Clostridium carboxidivorans P7
54% identity, 98% coverage
- Combination of Trace Metal to Improve Solventogenesis of Clostridium carboxidivorans P7 in Syngas Fermentation
Han, Frontiers in microbiology 2020 - “...ack Acetate kinase Ccar_19520 ptb Phosphate butyryltransferase Butyrate synthesis from butyral-CoA Ccar_19515 buk Butyrate kinase Ccar_07995 adh Acetaldehyde dehydrogenase Alcohol synthesis from acetyl-CoA and butyral-CoA Ccar_00050 bdh50 NAD(P)H-dependent butanol dehydrogenase Ccar_04610 bdh10 NADPH-dependent butanol dehydrogenase Ccar_24835 bdh35 NADPH-dependent butanol dehydrogenase Ccar_25840 bdh40 NADPH-dependent butanol dehydrogenase Ccar_01440...”
- “...changes in response to alteration of the Mo concentration ( Figure 5C ). One CDS (Ccar_07995), present in the chromosome with two adjacent copies, was characterized as being involved in the ethanol and butanol production pathways. This gene encodes a bifunctional alcohol/acetaldehyde dehydrogenase that is involved...”
CAETHG_3748, CLAU_3656 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Clostridium autoethanogenum DSM 10061
54% identity, 95% coverage
- The role of ethanol oxidation during carboxydotrophic growth of Clostridium autoethanogenum
Diender, Microbial biotechnology 2023 - “...ethanol oxidation The genome of C. autoethanogenum contains two AdhEencoding genes, AdhE1 (CAETHG_3747) and AdhE2 (CAETHG_3748), of which AdhE1 is thought to be the main AdhE, based on several fold higher transcript levels of AdhE1 compared to AdhE2 in autotrophic and heterotrophic growth conditions (de Lima...”
- “...ethanol oxidation. C. autoethanogenum carries genes for one additional AdhE with an Ald subunit (AdhE2, CAETHG_3748) and three additional monofunctional Ald genes (CAETHG_1819, 1830 & 3287), associated with gene clusters for bacterial microcompartments (BMCs), whose contribution to central carbon metabolism during growth on CO is not...”
- Required Gene Set for Autotrophic Growth of Clostridium autoethanogenum
Woods, Applied and environmental microbiology 2022 - “...encoded by an estimated five genes within the C. autoethanogenum genome (CLAU_1772, CLAU_1783, CLAU_3204, CLAU_3655, CLAU_3656), none of which appears to be required under either growth condition. This could represent redundancy between these genes, which further knockout studies could aim to confirm, or it could be...”
- Metabolic engineering of Clostridium autoethanogenum for selective alcohol production
Liew, Metabolic engineering 2017 - “...AOR isoforms: aor1 (CLAU_0081) and aor2 (CLAU_0099); and two AdhE enzymes: adhE1 (CLAU_3655) and adhE2 (CLAU_3656) that appear in tandem and are potentially a result of gene duplication ( Humphreys et al., 2015 ). The same arrangement is also found in C. ljungdahlii ( Kpke et...”
- Energy Conservation Associated with Ethanol Formation from H2 and CO2 in Clostridium autoethanogenum Involving Electron Bifurcation
Mock, Journal of bacteriology 2015 - “...adjacent open reading frames (CAETHG_3747 and CAETHG_3748) for bifunctional alcohol dehydrogenase/acetaldehyde dehydrogenase (CoA acetylating; AdhE). It is not...”
CAETHG_3747, CLAU_3655 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Clostridium autoethanogenum DSM 10061
53% identity, 97% coverage
- The role of ethanol oxidation during carboxydotrophic growth of Clostridium autoethanogenum
Diender, Microbial biotechnology 2023 - “...C. autoethanogenum adhE1a , lacking the Ald subunit of the main bifunctional aldehyde/alcohol dehydrogenase (AdhE, CAETHG_3747), has poor ethanol oxidation capabilities, with a negative impact on biomass yield. This indicates that the AdhAld route plays a major role in ethanol oxidation during carboxydotrophic growth, enabling subsequent...”
- “...role in carboxydotrophic ethanol oxidation The genome of C. autoethanogenum contains two AdhEencoding genes, AdhE1 (CAETHG_3747) and AdhE2 (CAETHG_3748), of which AdhE1 is thought to be the main AdhE, based on several fold higher transcript levels of AdhE1 compared to AdhE2 in autotrophic and heterotrophic growth...”
- Metabolic engineering of Clostridium autoethanogenum for ethyl acetate production from CO
Dykstra, Microbial cell factories 2022 - “...pta pta (CAETHG_3358) This study C. autoethanogenum adhE1a Knockout of the Ald subunit of adhE1 (CAETHG_3747) This study pMTL83151 pCB102, ColE1, traJ , Cm R /Tm R ( catP ) [ 23 ] pMTL83122 pMTL83121 P Thl [ 23 ] P Pta-AckA -Atf1 pMTL83151 P Pta-AckA...”
- “...pMTL83151, P fdx *-RbE- cas9 [ 24 ] pRECas1- adhE1a pRECas1, sgRNAand HA targeting adhE1a (CAETHG_3747) This study pSIBR003 Int3-FnCas12a [ 25 ] pMTL-SIBR-Cas pMTL83151, P Fdx - Int3- FnCas12a , P AraE -NTspacer This study pMTL-SIBR-Cas- pta pMTL-SIBR-Cas with spacerand HA targeting pta (CAETH_3358) This...”
- Required Gene Set for Autotrophic Growth of Clostridium autoethanogenum
Woods, Applied and environmental microbiology 2022 - “...be encoded by an estimated five genes within the C. autoethanogenum genome (CLAU_1772, CLAU_1783, CLAU_3204, CLAU_3655, CLAU_3656), none of which appears to be required under either growth condition. This could represent redundancy between these genes, which further knockout studies could aim to confirm, or it could...”
- Agr Quorum Sensing influences the Wood-Ljungdahl pathway in Clostridium autoethanogenum
Piatek, Scientific reports 2022 - “...groups: reduced and enhanced abundances for the agrD1D2 mutant. Bifunctional acetaldehyde-CoA/alcohol dehydrogenases AdhE1 and AdhE2 (CLAU_3655 and 3656), alcohol dehydrogenase (CLAU_1794) and aldehyde ferredoxin oxidoreductases (AOR) (CLAU_0099 and 0089) all were found in low abundance. The latter three enzymes are noted to play a role during...”
- Metabolic engineering of Clostridium autoethanogenum for selective alcohol production
Liew, Metabolic engineering 2017 - “...genes encoding two AOR isoforms: aor1 (CLAU_0081) and aor2 (CLAU_0099); and two AdhE enzymes: adhE1 (CLAU_3655) and adhE2 (CLAU_3656) that appear in tandem and are potentially a result of gene duplication ( Humphreys et al., 2015 ). The same arrangement is also found in C. ljungdahlii...”
- Energy Conservation Associated with Ethanol Formation from H2 and CO2 in Clostridium autoethanogenum Involving Electron Bifurcation
Mock, Journal of bacteriology 2015 - “...are two adjacent open reading frames (CAETHG_3747 and CAETHG_3748) for bifunctional alcohol dehydrogenase/acetaldehyde dehydrogenase (CoA acetylating; AdhE). It...”
- Comparison of single-molecule sequencing and hybrid approaches for finishing the genome of Clostridium autoethanogenum and analysis of CRISPR systems in industrial relevant Clostridia
Brown, Biotechnology for biofuels 2014 - “...Ac 2 Acetate kinase (Ack) CAETHG_3359. Ethanol fermentation pathway. E 1 Bifunctional aldehyde/alcohol dehydrogenase (AdhE) CAETHG_3747, 3748, E 2 Aldehyde:Fd oxidoreductase (AOR) CAETHG_0092, 0102, E 3 Additional alcohol dehydrogenases (Adh) CAETHG_0555. 2,3-butanediol fermentation pathway. B 1 Acetolactate synthase (AlsS) CAETHG_0124-25, 0406, 1740, B 2 Acetolactate decarboxylase...”
CLJU_c16510 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Clostridium ljungdahlii DSM 13528
53% identity, 97% coverage
- Protein acetylation-mediated cross regulation of acetic acid and ethanol synthesis in the gas-fermenting Clostridium ljungdahlii
Liu, The Journal of biological chemistry 2022 - “...the same steps and using different primers. Gene expression and protein purification The CLJU_c12770, CLJU_c12780, CLJU_c16510, CLJU_c16520, CLJU_c20110, CLJU_c20210, and CLJU_c37250 genes, coding for Pta, Ack, AdhE1, AdhE2, Aor1, Aor2, and Rex, respectively, were expressed for the production of the corresponding proteins. For example, the pta...”
- The Metabolism of Clostridium ljungdahlii in Phosphotransacetylase Negative Strains and Development of an Ethanologenic Strain
Lo, Frontiers in bioengineering and biotechnology 2020 - “...al., 2015 ). There are two annotated adhE genes in the genome, adhE1 and adhE2 (CLJU_c16510 and CLJU_c16520), which are colocalized in the genome. It was previously shown that disruption of adhE1 but not adhE2 resulted in a decrease in ethanol when grown on fructose (...”
- Ethanol Metabolism Dynamics in Clostridium ljungdahlii Grown on Carbon Monoxide
Liu, Applied and environmental microbiology 2020 (secret) - Biofilm Formation by Clostridium ljungdahlii Is Induced by Sodium Chloride Stress: Experimental Evaluation and Transcriptome Analysis
Philips, PloS one 2017 - “...acetate were significantly upregulated (Table N in S2 File ). In contrast, the gene adhE1 (CLJU_c16510), mainly responsible for the production of ethanol by C . ljungdahlii [ 13 ], was strongly downregulated. Also a gene encoding a putative aldehyde oxidoreductase (CLJU_c24130), which was involved in...”
- Industrial Acetogenic Biocatalysts: A Comparative Metabolic and Genomic Analysis
Bengelsdorf, Frontiers in microbiology 2016 - “...P pta-ack ( Table 1 ). In order to disrupt the adhE1 gene (locus tag CLJU_c16510) encoding a bifunctional aldehyde/alcohol dehydrogenase in C. ljungdahlii , we used the ClosTron TM system ( Heap et al., 2010 ). This system permitted a directed construction of stable mutants...”
- “...target site was between nucleotides 114 and 115 of the nucleotide sequence of adhE1 gene (CLJU_c16510). The resulting intron targeting region sequence (309 bp) was synthesized by the company DNA2.0 (Menlo Park, CA, USA) and cloned into the vector pMTL007C-E2. The final plasmid (pMTL007C-E2_adhE1::intron) was used...”
- Metabolic response of Clostridium ljungdahlii to oxygen exposure
Whitham, Applied and environmental microbiology 2015 - “...Log2 FC CLJU_c11960 CLJU_c12770 CLJU_c12780 CLJU_c16510 CLJU_c20110 Predicted acetaldehyde dehydrogenase Phosphotransacetylase Acetate kinase Bifunctional...”
- “...presented in Table 1. Although AdhE1 (encoded by CLJU_c16510) was previously identified to be the primary ethanol dehydrogenase in C. ljungdahlii (3, 17), its...”
- Energy Conservation Associated with Ethanol Formation from H2 and CO2 in Clostridium autoethanogenum Involving Electron Bifurcation
Mock, Journal of bacteriology 2015 - “...for the putative bifunctional aldehyde/alcohol dehydrogenases, adhE1 (CLJU_c16510) and adhE2 (CLJU_c16520), are arranged the same way and have been deleted...”
- Lactose-inducible system for metabolic engineering of Clostridium ljungdahlii
Banerjee, Applied and environmental microbiology 2014 - “...Melville (Virginia Tech). The C. ljungdahlii adhE1 (CLJU_c16510), and adhE2 (CLJU_c16520) genes were amplified with primer sets AdhE1ForiSD-AdhE1compBmR1 and...”
- More
CLJU_c16520 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Clostridium ljungdahlii DSM 13528
54% identity, 95% coverage
- Protein acetylation-mediated cross regulation of acetic acid and ethanol synthesis in the gas-fermenting Clostridium ljungdahlii
Liu, The Journal of biological chemistry 2022 - “...same steps and using different primers. Gene expression and protein purification The CLJU_c12770, CLJU_c12780, CLJU_c16510, CLJU_c16520, CLJU_c20110, CLJU_c20210, and CLJU_c37250 genes, coding for Pta, Ack, AdhE1, AdhE2, Aor1, Aor2, and Rex, respectively, were expressed for the production of the corresponding proteins. For example, the pta gene...”
- The Metabolism of Clostridium ljungdahlii in Phosphotransacetylase Negative Strains and Development of an Ethanologenic Strain
Lo, Frontiers in bioengineering and biotechnology 2020 - “...). There are two annotated adhE genes in the genome, adhE1 and adhE2 (CLJU_c16510 and CLJU_c16520), which are colocalized in the genome. It was previously shown that disruption of adhE1 but not adhE2 resulted in a decrease in ethanol when grown on fructose ( Leang et...”
- Ethanol Metabolism Dynamics in Clostridium ljungdahlii Grown on Carbon Monoxide
Liu, Applied and environmental microbiology 2020 (secret) - Energy Conservation Associated with Ethanol Formation from H2 and CO2 in Clostridium autoethanogenum Involving Electron Bifurcation
Mock, Journal of bacteriology 2015 - “...bifunctional aldehyde/alcohol dehydrogenases, adhE1 (CLJU_c16510) and adhE2 (CLJU_c16520), are arranged the same way and have been deleted individually or...”
- Lactose-inducible system for metabolic engineering of Clostridium ljungdahlii
Banerjee, Applied and environmental microbiology 2014 - “...ljungdahlii adhE1 (CLJU_c16510), and adhE2 (CLJU_c16520) genes were amplified with primer sets AdhE1ForiSD-AdhE1compBmR1 and AdhE2ForiSD-AdhE2compBmR,...”
- A genetic system for Clostridium ljungdahlii: a chassis for autotrophic production of biocommodities and a model homoacetogen
Leang, Applied and environmental microbiology 2013 - “...coding region from 34 Val to 775 Arg of adhE2 (CLJU_c16520) was replaced with the gene ermC. For construction of a mutant allele to disrupt adhE2, the upstream...”
- “...evaluated for proof of concept. CLJU_c16510 and CLJU_c16520, designated adhE1 and adhE2, respectively, have Genetic System for Clostridium ljungdahlii...”
DMR38_08340 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Clostridium sp. AWRP
53% identity, 97% coverage
CPE2531 aldehyde-alcohol dehydrogenase E from Clostridium perfringens str. 13
52% identity, 98% coverage
lp_3662 bifunctional protein: alcohol dehydrogenase; acetaldehyde dehydrogenase from Lactobacillus plantarum WCFS1
52% identity, 98% coverage
- Transcriptomes reveal genetic signatures underlying physiological variations imposed by different fermentation conditions in Lactobacillus plantarum
Bron, PloS one 2012 - “...expressed at a lower level in the presence of oxygen, like alcohol dehydrogenase ( adhE; lp_3662 ) and acetaldehyde dehydrogenase ( acdH ; lp_0329 ), which may very well relate to their role in maintenance of the redox balance during anaerobic fermentation [44] . Detailed analysis...”
- Inactivation of PadR, the repressor of the phenolic acid stress response, by molecular interaction with Usp1, a universal stress protein from Lactobacillus plantarum, in Escherichia coli
Gury, Applied and environmental microbiology 2009 - “...found in the same locus in the strain WCFS1 (lp_3662). Northern blot hybridization was performed using RNA samples from cultures of L. plantarum, with or...”
- Spatial and temporal expression of Lactobacillus plantarum genes in the gastrointestinal tracts of mice
Marco, Applied and environmental microbiology 2007 - “...lp_1403 lp_1603 lp_2940 lp_3055 lp_3176 lp_3473 lp_3660 lp_3662 lp_0006 lp_0537 lp_0727 lp_1021 lp_1027 lp_1144 lp_1898 lp_2187 lp_2301 General Locus taga TABLE...”
CBY_3753 aldehyde-alcohol dehydrogenase 2 from Clostridium butyricum 5521
52% identity, 96% coverage
- Reduced catabolic protein expression in Clostridium butyricum DSM 10702 correlate with reduced 1,3-propanediol synthesis at high glycerol loading
Gungormusler-Yilmaz, AMB Express 2014 - “...of the proteins involved in the butyrate synthesis pathways such as a putative ethanol dehydrogenase (CBY_3753) and a 3-hydroxybutyryl-CoA dehydrogenase (CBY_3045) were up-regulated in both exponential and stationary growth phases. Expression levels of proteins (CBY_0500, CBY_0501 and CBY_0502) involved in the reductive pathway of glycerol to...”
- “...0.22 1.01 1.11 CBY_3751 NADPH-dependent butanol dehydrogenase 0.23 0.08 0.36 0.26 0.53 0.18 0.57 0.94 CBY_3753 Ethanol dehydrogenase (aldehyde-alcohol dehydrogenase 2) 2.58 1.08 2.61 4.78 0.27 0.12 0.15 0.01 CBY_9999 glycerol uptake facilitator protein NQ NQ NQ NQ NQ NQ NQ NQ NQ: Not quantifiable. a...”
CBO0345 aldehyde-alcohol dehydrogenase from Clostridium botulinum A str. ATCC 3502
53% identity, 99% coverage
F502_06447 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Clostridium pasteurianum DSM 525 = ATCC 6013
52% identity, 97% coverage
adhE2 / Q9ANR5 aldehyde dehydrogenase/alcohol dehydrogenase (EC 1.2.1.57) from Clostridium acetobutylicum (see 4 papers)
CAP0035, CA_P0035 Aldehyde-alcohol dehydrogenase, ADHE1 from Clostridium acetobutylicum ATCC 824
Q7DFN2 Aldehyde-alcohol dehydrogenase from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q9ANR5 Aldehyde-alcohol dehydrogenase from Clostridium acetobutylicum
CEA_P0034 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Clostridium acetobutylicum EA 2018
53% identity, 99% coverage
- Co‑cultivation of anaerobic fungi with Clostridium acetobutylicum bolsters butyrate and butanol production from cellulose and lignocellulose
Brown, Journal of industrial microbiology & biotechnology 2023 - “...grown in Medium B controls without fungal supernatant. Overall, the high expression of the gene (CA_P0035) that produces the enzyme acetaldehyde dehydrogenase (EC 1.2.1.10)/alcohol dehydrogenase AdhE (EC 1.1.1.1) is in agreement with the high levels of ethanol production relative to acetate. The lack of butanol would...”
- Establishing Butyribacterium methylotrophicum as a Platform Organism for the Production of Biocommodities from Liquid C1 Metabolites
Humphreys, Applied and environmental microbiology 2022 (secret) - Production of the biocommodities butanol and acetone from methanol with fluorescent FAST-tagged proteins using metabolically engineered strains of Eubacterium limosum
Flaiz, Biotechnology for biofuels 2021 - “...recombinant E. limosum strains FAST was fused to the C- or the N-terminus of AdhE2 (CA_P0035) using a flexible glycine linker. The resulting fusion proteins were used to examine the impact of the fluorescent FAST tag on functionality and productivity of AdhE2. Both AdhE2 fusion proteins...”
- A CRISPR/Anti-CRISPR Genome Editing Approach Underlines the Synergy of Butanol Dehydrogenases in Clostridium acetobutylicum DSM 792
Wasels, Applied and environmental microbiology 2020 (secret) - Improved n-Butanol Production from Clostridium cellulovorans by Integrated Metabolic and Evolutionary Engineering
Wen, Applied and environmental microbiology 2019 - “...located in the sol operon orfL-adhE1-ctfA-ctfB) and adhE2 (CA_p0035, a monocistronic operon) in the C. acetobutylicum ATCC 824 strain (32, 33). The effect of...”
- “...overexpression Derived from pXY1-Pthl, with adhE2 (CA_p0035) gene from C. acetobutylicum overexpression Derived from pXY1-Pthl, with ctfAB-adc cassette...”
- Elucidation of the roles of adhE1 and adhE2 in the primary metabolism of Clostridium acetobutylicum by combining in-frame gene deletion and a quantitative system-scale approach
Yoo, Biotechnology for biofuels 2016 (no snippet) - A water-forming NADH oxidase regulates metabolism in anaerobic fermentation
Shi, Biotechnology for biofuels 2016 (no snippet) - A Quantitative System-Scale Characterization of the Metabolism of Clostridium acetobutylicum
Yoo, mBio 2015 - “...(0.24 0.04), NADPH (2.21 0.41) CA_P0162 adhE1 Butanol dehydrogenase NADH (0.04 0.02), NADPH (not detected) CA_P0035 adhE2 Butanol dehydrogenase NADH (4.8 0.42), NADPH (0.12 0.01) CA_P0162 adhE1 Butyraldehyde dehydrogenase NADH (2.27 0.21), NADPH (0.08 0.01) CA_P0035 adhE2 Butyraldehyde dehydrogenase NADH (2.5 0.31), NADPH (0.07 0.01) CA_C2711-CA_C2709...”
- “...glycerol utilization in alcohologenic metabolism ( 6 , 9 ). High upregulation (160-fold) of adhE2 (CA_P0035), which is involved in alcohol production under alcohologenic conditions ( 66 ), was detected and correlated with a high AdhE2 protein concentration. Interestingly, CA_C3486, which encodes a multimeric flavodoxin, was...”
- More
- Genetic and nutrient modulation of acetyl-CoA levels in Synechocystis for n-butanol production.
Anfelt, Microbial cell factories 2015 - “...pJA2 backbone. The exogenous genes phaJ , ter and adhE2 (Uniprot entry O32472, Q73Q47 and Q7DFN2, respectively) were codon optimized and synthesized as one single construct by Epoch Life Science. A unique tag enabling immunodetection was introduced directly downstream of the start codon in all three...”
- A microbial platform for renewable propane synthesis based on a fermentative butanol pathway
Menon, Biotechnology for biofuels 2015 - “...by subcloning synthesized gene encoding AdhE2 (aldehyde-alcohol dehydrogenase, from C. acetobutylicum ATCC 824, GenBank ID: Q9ANR5) from a pUC57 parent vector provided by GenScript into pET-Duet vector, using restriction sites NcoI and AvrII. pCDF-ADO and pCDF-ADO A134F The pCDF-ADO plasmid was constructed in a pCDFDuet-1 vector...”
- Comparative genomic and transcriptomic analysis revealed genetic characteristics related to solvent formation and xylose utilization in Clostridium acetobutylicum EA 2018
Hu, BMC genomics 2011 - “...in ATCC 824 Product Name Solvent formation related genes CEA_G0028 CAC0028 -12(T) -12(C) Hydrogen dehydrogenase CEA_P0034 CA_P0035 -84(T) -84(C) Aldehyde-alcohol dehydrogenase, ADHEII Substrate utilization related genes CEA_G3043 CAC3037 -80(T) -80(C) Catabolite control protein, LacI family transcriptional regulator CEA_G3455 CAC3451 -84(T) -84(G) Sugar/Na+(H+) simporter CEA_G1086 CAC1075 -56(T)...”
- “...repeats containing protein CEA_G3701 CA_C3694 -43(T) -43(C) 4.045439 3.430925 3.859781 3.69948 4.131629 3.75554 TPR-repeat-containing protein CEA_P0034 CA_P0035 -84(T) -84(C) 3.331902 5.740285 6.007483 8.056546 6.576379 7.664691 Aldehyde-alcohol dehydrogenase, AdhEII Changes in expression of adhEII , spo0A and hydrogenase gene may contribute to enhanced solvent formation in EA...”
CtherDRAFT_1096 iron-containing alcohol dehydrogenase from Clostridium thermocellum DSM 4150
53% identity, 97% coverage
A0A0H3W5U9 alcohol dehydrogenase [NAD(P)+] (EC 1.1.1.71); acetaldehyde dehydrogenase (acetylating) (EC 1.2.1.10) from Acetivibrio thermocellus (see 3 papers)
A3DCI2 alcohol dehydrogenase (EC 1.1.1.1); acetaldehyde dehydrogenase (acetylating) (EC 1.2.1.10) from Acetivibrio thermocellus (see 4 papers)
Cthe_0423 iron-containing alcohol dehydrogenase from Clostridium thermocellum ATCC 27405
Clo1313_1798 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Acetivibrio thermocellus ATCC 27405
53% identity, 97% coverage
- Integrated omics analyses reveal the details of metabolic adaptation of Clostridium thermocellum to lignocellulose-derived growth inhibitors released during the deconstruction of switchgrass
Poudel, Biotechnology for biofuels 2017 - “...3) catalyzing pyruvatelactate, pyruvate formate lyase (Cthe_0505 and Cthe_0506; cluster 4) catalyzing pyruvateformate, and AdhE (Cthe_0423; cluster 4), a bidirectional acetaldehyde/CoA dehydrogenase. This enzyme functions as both an alcohol dehydrogenase and acetaldehyde dehydrogenase and is the major driver of ethanol production in C. thermocellum and other...”
- Specialized activities and expression differences for Clostridium thermocellum biofilm and planktonic cells
Dumitrache, Scientific reports 2017 - “...(Cthe_1028) was >13-fold overexpressed in biofilms, while ethanol production through the bifunctional acetaldehyde-CoA/alcohol dehydrogenase gene (Cthe_0423 or adhE ) did not show significant differential expression. The expression of adhE ranked in the top 5 percentile for SS and PL populations, and also highly expressed with little...”
- Physiological, metabolic and biotechnological features of extremely thermophilic microorganisms
Counts, Wiley interdisciplinary reviews. Systems biology and medicine 2017 - “...bescii through the addition of an NADH-dependent alcohol dehydrogenase gene from Clostridium thermocellum ( adhE Cthe_0423) into the strain lacking lactate formation 158 ; C. bescii does not possess a native alcohol or acetaldehyde dehydrogenase, and thus a representative gene was recruited from another thermophilic Firmicute....”
- Alcohol Selectivity in a Synthetic Thermophilic n-Butanol Pathway Is Driven by Biocatalytic and Thermostability Characteristics of Constituent Enzymes
Loder, Applied and environmental microbiology 2015 - “...the supplemental material and ligated into pET-46 Ek/LIC. Cthe_0423 (C. thermocellum adhE [Ctherm-adhE]) was amplified by PCR from C. thermocellum ATCC 27405...”
- “...Cbei_3832 CA_C3298 TTE0549 TTE0548 TTE0544 STHERM_c16300 Cthe_0423 Teth514_0627 Teth514_1942 Teth514_1935 Homology to Enzyme query Sequence- SDS- Purityc MMd...”
- Cellulosic ethanol production via consolidated bioprocessing at 75 °C by engineered Caldicellulosiruptor bescii
Chung, Biotechnology for biofuels 2015 - “...thermocellum and T. pseudethanolicus 39E. a The C. thermocellum ethanol pathway. The red colored AdhE (Cthe_0423) is already expressed and tested in C. bescii [ 26 ]. b The T. pseudethanolicus 39E ethanol pathway. The green colored AdhE (Teth39_0206) and blue colored AdhB (Teth39_0218) are expressed...”
- Transcriptomic analysis of Clostridium thermocellum Populus hydrolysate-tolerant mutant strain shows increased cellular efficiency in response to Populus hydrolysate compared to the wild type strain
Linville, BMC microbiology 2014 - “...1.83 Cthe_0101 iron-containing alcohol dehydrogenase 1.35 1.19 2.19 1.20 1.22 1.04 1.18 1.82 2.43 1.48 Cthe_0423 iron-containing alcohol dehydrogenase 1.12 1.07 4.75 5.02 1.26 1.06 1.28 1.45 3.36 4.42 Bold values indicate significantly different levels of expression as determined by ANOVA. For the PM vs. WT...”
- Comparison of transcriptional profiles of Clostridium thermocellum grown on cellobiose and pretreated yellow poplar using RNA-Seq
Wei, Frontiers in microbiology 2014 - “...(Figure 6 ). The up-regulation of two out of four alcohol dehydrogenase (ADH) genes, namely Cthe_0423 (FC value 7.0) and Cthe_0394 (FC value 5.3), raise the average FC value for ADHs to 3.6. In contrast, the phosphotransacetylase (PTA; Cthe_1029), whose activity had been verified in C....”
- A comparative multidimensional LC-MS proteomic analysis reveals mechanisms for furan aldehyde detoxification in Thermoanaerobacter pseudethanolicus 39E
Clarkson, Biotechnology for biofuels 2014 - “...discussed in more detail below. In C. thermocellum ATCC 27405 , the bifunctional alcohol/aldehyde dehydrogenase Cthe_0423 and the redox regulator Rex (Cthe_0422) were downregulated upon furfural addition [ 37 ]. No other alcohol dehydrogenase or aldehyde reductase was differentially regulated; however, a putative carbon monoxide dehydrogenase...”
- More
- The role of AdhE on ethanol tolerance and production in Clostridium thermocellum
Pech-Canul, The Journal of biological chemistry 2024 - “...Fig.S6 ). Several genes in C.thermocellum have been annotated as putative ADHs, including Clo1313_0076, Clo1313_0166, Clo1313_1798 ( adhE ), Clo1313_1827, Clo1313_1833, and Clo1313_2130 that may be responsible for this activity. Thus, in the mutants with reduced ADH activity, acetaldehyde to ethanol conversion could be due to...”
- Ethanol tolerance in engineered strains of Clostridium thermocellum
Olson, Biotechnology for biofuels and bioproducts 2023 - “...of C. thermocellum is included for context [ 6 , 7 , 16 ] AdhE (Clo1313_1798) The most frequently mutated gene was adhE . All 11 of the lineages sequenced had mutations at this locus. Most of the mutations in the adhE gene were frameshift (fs)...”
- Ethanol tolerance of Clostridium thermocellum: the role of chaotropicity, temperature and pathway thermodynamics on growth and fermentative capacity
Kuil, Microbial cell factories 2022 - “...:: ldh* This study AVM062 AVM002 C. thermocellum DSM1313 P clo1313_2638 :: ldh* adhE ( clo1313_1798 ) This study *Contained a single T950A point mutation in the ldh gene resulting in an I317K amino acid substitution Plasmid construction All plasmids used in this study are listed...”
- “...C. thermocellum ldh downstream of the clo1313_2638 promoter region ON809520 This study pTK25 adhE ( clo1313_1798 ) markerless deletion vector ON809521 This study *Contained a single T950A point mutation in the ldh gene resulting in an I317K amino acid substitution Strain construction Clostridium thermocellum transformations, selection,...”
8uhwB / A3DCI2 The structure of the clostridium thermocellum adhe spirosome
53% identity, 99% coverage
- Ligand: fe (iii) ion (8uhwB)
CDR20291_2800 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Clostridioides difficile R20291
CDR20291_2800 aldehyde-alcohol dehydrogenase [includes: alcohol dehydrogenase and pyruvate-formate-lyase deactivase from Clostridium difficile R20291
52% identity, 96% coverage
CD2966 aldehyde-alcohol dehydrogenase [includes: alcohol dehydrogenase and pyruvate-formate-lyase deactivase from Clostridium difficile 630
52% identity, 98% coverage
- Role of the global regulator Rex in control of NAD+ -regeneration in Clostridioides (Clostridium) difficile
Bouillaut, Molecular microbiology 2019 - “...CoA to butyryl CoA (CD1054CD1059); (5) ethanolamine utilization (CD1906-CD1925, eut ); and (6) alcohol dehydrogenase (CD2966, adhE ). In the prdR mutant, the prd genes were underexpressed, but the other indicated pathways were all overexpressed at least 5-fold compared to the wild-type. Figure 2 Effects of...”
- “...production 5.929.26 0.030.05 Fermentation CD23382344 4hbD*,cat2*, abfD*, sucD, cat1 Succinate utilization 3.33 10.44 0.04.0.17 Fermentation CD2966 adhE Aldehyde-alcohol dehydrogenase 12.77 0.05 Membrane Transport CD03240327 cbiM, cbiN, cbiQ, cbiO Cobalamin biosynthesis protein, cobalt ABC-type transport system 8.0412.07 0.250.27 Membrane Transport CD26662667 ptsG-A, ptsG-BC PTS system, glucose-specific transporter...”
- Ethanolamine is a valuable nutrient source that impacts Clostridium difficile pathogenesis
Nawrocki, Environmental microbiology 2018 - “...five predicted alcohol dehydrogenases that could potentially compensate for the loss of EutG: CD0274, CD0334, CD2966, CD3006 and CD3105 . However, the expression and functions of these factors in ethanolamine metabolism have not been investigated. As observed in other species that encode extensive ethanolamine utilization mechanisms,...”
- Adaptive strategies and pathogenesis of Clostridium difficile from in vivo transcriptomics
Janoir, Infection and immunity 2013 - “...CD2429 and CD2380-CD2381, ferredoxin oxidoreductases; CD2966 and CD0334, aldehyde-alcohol dehydrogenases; CD1059, acetyl-CoA acetyltransferase; CD1058,...”
- “...found that genes encoding the aldehyde-alcohol dehydrogenase (CD2966), probably involved in ethanol and butanol production from acetyl-CoA and butyryl-CoA,...”
- Global transcriptional control by glucose and carbon regulator CcpA in Clostridium difficile
Antunes, Nucleic acids research 2012 - “...CD2666), PTS glucose-specific IIA, IICB; pmi (CD2491), mannose-6-phosphate isomerase; rbsBAC (CD0300CD0302), ribose ABC transporter; adhE (CD2966) and CD3006, aldehyde-alcohol dehydrogenase; thlA (CD1059), acetyl-CoA acetyltransferase; hbd (CD1058), 3-hydroxybutyryl-CoA dehydrogenase; crt2 (CD1057), 3-hydroxybutyryl-CoA dehydratase; cat1 (CD2343), succinyl-CoA: coenzyme A transferase; sucD (CD2342), succinate-semialdehyde dehydrogenase; 4hbd (CD2338), 4-hydroxybutyrate dehydrogenase;...”
- “...from acetyl-CoA (CD1054CD1059) or succinate (CD2344CD2338) and the further production of butyrate (CD0112CD0113) or butanol (CD2966) from butyryl-CoA were repressed by glucose through a CcpA-dependent mechanism ( Figure 5 , Supplementary Tables S2 and S4 ). Among these genes, cre CD sites are present inside the...”
- The key sigma factor of transition phase, SigH, controls sporulation, metabolism, and virulence factor expression in Clostridium difficile
Saujet, Journal of bacteriology 2011 - “...production from succinate, and of two adhE genes (CD2966 and CD3006), encoding alcohol dehydrogenases, decreased after 10 h of growth. In contrast, the...”
CD630_29660, CDIF630erm_03250 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Clostridioides difficile
52% identity, 96% coverage
- The WalRK Two-Component System Is Essential for Proper Cell Envelope Biogenesis in Clostridioides difficile
Müh, Journal of bacteriology 2022 - “...Hypothetical protein 2.67 2.75 1.35 Membrane cd630_27680 27680 Cell wall hydrolase 2.06 2.29 NC SPI cd630_29660 29660 adhE1 Acetaldehyde-CoA/alcohol dehydrogenase 2.08 2.37 1.09 Membrane cd630_18120 18120 Response regulator 2.08 2.28 NC cd630_22600 22600 Major facilitator superfamily transporter 2.13 2.32 NC Membrane cd630_20160 20160 Hypothetical protein 2.19...”
- Iron Regulation in Clostridioides difficile
Berges, Frontiers in microbiology 2018 - “...3-hydroxybutyryl-CoA dehydrogenase -5.21 OFF -5.97 OFF CD630_10590 CDIF630erm_01199 thlA1 Acetyl-CoA acetyltransferase -6.22 OFF -6.43 OFF CD630_29660 CDIF630erm_03250 adhE Bifunctional acetaldehyde-CoA/alcohol dehydrogenase -8.19 -4.52 -9.86 -5.91 CD630_23380 CDIF630erm_02577 4hbD 4-hydroxybutyrate dehydrogenase -1.00 -0.87 -1.23 -1.06 02575 CD630_23390 CDIF630erm_02578 cat2 4-hydroxybutyrate CoA-transferase -0.87 OFF -0.50 OFF CD630_23400 CDIF630erm_02579...”
- “...dehydrogenase -5.21 OFF -5.97 OFF CD630_10590 CDIF630erm_01199 thlA1 Acetyl-CoA acetyltransferase -6.22 OFF -6.43 OFF CD630_29660 CDIF630erm_03250 adhE Bifunctional acetaldehyde-CoA/alcohol dehydrogenase -8.19 -4.52 -9.86 -5.91 CD630_23380 CDIF630erm_02577 4hbD 4-hydroxybutyrate dehydrogenase -1.00 -0.87 -1.23 -1.06 02575 CD630_23390 CDIF630erm_02578 cat2 4-hydroxybutyrate CoA-transferase -0.87 OFF -0.50 OFF CD630_23400 CDIF630erm_02579 Hypothetical...”
CD0334 aldehyde-alcohol dehydrogenase [includes: alcohol dehydrogenase; acetaldehyde dehydrogenase [acetylating]; pyruvate-formate-lyase deactivase from Clostridium difficile 630
Q18D77 Aldehyde-alcohol dehydrogenase from Clostridioides difficile (strain 630)
52% identity, 96% coverage
- Ethanolamine is a valuable nutrient source that impacts Clostridium difficile pathogenesis
Nawrocki, Environmental microbiology 2018 - “...another five predicted alcohol dehydrogenases that could potentially compensate for the loss of EutG: CD0274, CD0334, CD2966, CD3006 and CD3105 . However, the expression and functions of these factors in ethanolamine metabolism have not been investigated. As observed in other species that encode extensive ethanolamine utilization...”
- Adaptive strategies and pathogenesis of Clostridium difficile from in vivo transcriptomics
Janoir, Infection and immunity 2013 - “...ferredoxin oxidoreductases; CD2966 and CD0334, aldehyde-alcohol dehydrogenases; CD1059, acetyl-CoA acetyltransferase; CD1058,...”
- Conserved Streptococcus pneumoniae spirosomes suggest a single type of transformation pilus in competence.
Laurenceau, PLoS pathogens 2015 - “...(-) 48% 66% N1K5R4 Yersinia enterocolitica (-) 47% 65% E7NR96 Treponema phagedenis (-) 47% 65% Q18D77 Clostridium difficile (+) 47% 64% A4ECL0 Collinsella aerofaciens (+) 47% 63% In addition to S . pneumoniae , we observed spirosome release in cultures of Clostridium difficile , Streptococcus sanguinis...”
X276_25300 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Clostridium beijerinckii NRRL B-598
51% identity, 97% coverage
LAR_RS01690 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Limosilactobacillus reuteri subsp. reuteri JCM 1112
A5VIB7 Aldehyde-alcohol dehydrogenase from Limosilactobacillus reuteri (strain DSM 20016)
51% identity, 97% coverage
Cbei_0305 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Clostridium beijerincki NCIMB 8052
51% identity, 97% coverage
- Transcriptional analysis of degenerate strain Clostridium beijerinckii DG-8052 reveals a pleiotropic response to CaCO3-associated recovery of solvent production
Jiao, Scientific reports 2016 - “...no change in their expression in response to CaCO 3 . The aldehyde dehydrogenase (Cbei_2518, Cbei_0305 and Cbei_4936) showed up-regulation folds from +4.33, +3.36, +164.7 (acidogenisis) to +4.83, +4.01, +39.86 (solventogensis), separately. Alcohol dehydrogenase (Cbei_4552, Cbei_4354 and Cbei_1937) were also all up-transcripted from +3.42, +8.44, +159.77...”
- Whole-genome sequence of an evolved Clostridium pasteurianum strain reveals Spo0A deficiency responsible for increased butanol production and superior growth
Sandoval, Biotechnology for biofuels 2015 - “...coding for an aldehyde dehydrogenase ( ald , Cbei_3832 ). A bifunctional adhE gene ( Cbei_0305 ) is located in another locus. The adc gene ( Cbei_3835 ) is oriented in the same orientation as ald , ctfA , and ctfB and these are all transcribed...”
IVR12_01636 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Limosilactobacillus reuteri
50% identity, 97% coverage
KW89_2115 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Piscirickettsia salmonis
50% identity, 98% coverage
- Analysis of Piscirickettsia salmonis Metabolism Using Genome-Scale Reconstruction, Modeling, and Testing
Cortés, Frontiers in microbiology 2017 - “...48.3 PSLF89_3283 AKP74767.1 Glycosyltransferase Q58577.1| Y1178_METJA 34.2 PSLF89_3284 AKP74768.1 Glycosyltransferase D6Z995.1| MSHA_SEGRD 30.2 clade G2 KW89_2115 ALA25581.1 Bifunctional acetaldehyde-CoA/alcohol dehydrogenase P0A9Q8.2| ADHE_ECO57 70 KW89_2719 ALA26181.1 Aldehyde dehydrogenase P33008.1| ALDH_PSESP 40 KW89_436 ALA23905.1 Tryptophan dioxygenase Q1CVR6.1| T23O_MYXXD 29 KW89_869 ALA24337.1 dCTP deaminase A4T0X9.1| DCD_MYCGI 32 KW89_2210 ALA25676.1...”
ETAE_1508 aldehyde-alcohol dehydrogenase from Edwardsiella tarda EIB202
50% identity, 96% coverage
Ccel_3198 iron-containing alcohol dehydrogenase from Clostridium cellulolyticum H10
50% identity, 99% coverage
- Recent Developments of the Synthetic Biology Toolkit for Clostridium
Joseph, Frontiers in microbiology 2018 - “...bp del NR NR 43 xylR 1149 bp del C. cellulolyticum NR NR NR NR Ccel_3198 ** 120 bp ins Xu et al., 2017 Type Species Target strand Repression (%) dCas9 expression Gene targeted Citation dCas9 C. beinjerinckii NR 6595 thl amy Wang et al., 2016b...”
- “...protein in the native C. pasteurianum type I-B CRISPR system. ** Targeted region downstream of Ccel_3198 gene . The limited number of characterized genetic parts for Clostridium poses a challenge with CRISPR/Cas9 engineering. For example, simultaneous constitutive expression of the sgRNA and Cas9 protein often resulted...”
- Cas9 Nickase-Assisted RNA Repression Enables Stable and Efficient Manipulation of Essential Metabolic Genes in Clostridium cellulolyticum
Xu, Frontiers in microbiology 2017 - “...The 23-bp target site (5 -AAGTAAGAAACATTTGGTTCCGG-3 ) was located in the downstream intergenic region of Ccel_3198. pCas9n-3198D with a customized donor was constructed in two steps. First, pCas9n-3198D reported previously was linearized by BamHI ( Xu et al., 2015 ) and then assembled with both left...”
- “...immediately downstream of the sole bifunctional acetaldehyde-CoA/alcohol dehydrogenase-encoding gene ( adhE ) in C. cellulolyticum (Ccel_3198). The specific integration can generate an artificial bicistronic operon containing the open reading frames of adhE and mlsR under the control of the native adhE promoter, consequently enabling counter selection...”
- Linking genome content to biofuel production yields: a meta-analysis of major catabolic pathways among select H2 and ethanol-producing bacteria
Carere, BMC microbiology 2012 - “...Ethha_0051 Ethha_1385 Ettha_0635 Ethha_0580 Ethha_1164 Ethha_2217 Ethha_2239 C. cellulolyticum H10 Ccel_2137 Ccel_2136 Ccel_0494 Ccel_1469 Ccel_0894 Ccel_3198 Ccel_1083 Ccel_3337 C. phytofermentans ISDg Cphy_1326 Cphy_132 Cphy_0958 Cphy_1029 Cphy_3925 Cphy_1178 Cphy_1421 Cphy_1416 Cphy_2463 Cphy_1428 Cphy_2463 Cphy_2418 Cphy_2642 Cphy_3041 C. thermocellum ATCC 27405 Cthe_1029 Cthe_1028 Cthe_0551 Cthe_2238 Cthe_0101 Cthe_0423 Cthe_0394...”
ADH1 / A8JI07 alcohol dehydrogenase / acetaldehyde dehydrogenase (EC 1.2.1.10; EC 1.1.1.1) from Chlamydomonas reinhardtii (see 2 papers)
50% identity, 89% coverage
NT01EI_1665 aldehyde-alcohol dehydrogenase 2 from Edwardsiella ictaluri 93-146
50% identity, 96% coverage
B1745_05695 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Lactobacillus amylolyticus
49% identity, 98% coverage
- Adaptive mechanism of Lactobacillus amylolyticus L6 in soymilk environment based on metabolism of nutrients and related gene-expression profiles
Fei, Food science & nutrition 2022 - “...B1745_05615 nagZ beta N acetylhexosaminidase 3.54 B1745_05130 glvA 6phosphoalphaglucosidase 3.26 B1745_03165 ldh Llactate dehydrogenase 3.18 B1745_05695 adhE acetaldehyde dehydrogenase /alcohol dehydrogenase 2.67 B1745_RS08070 galA alphagalactosidase 2.32 B1745_01765 scrA PTS betaglucoside transporter subunit EIIBCA 1.98 B1745_04615 spp HAD family hydrolase 1.93 B1745_03820 gyaR hypothetical protein 1.80 B1745_03825...”
- “...in the log phase (Table 2 ). In addition, it was also observed that adhE (B1745_05695) encoding acetaldehyde hydrogenase related to acetic acid production was upregulated in the log phase. Therefore, high expression of LDH and adhE genes promotes the production of lactic acid and acetic...”
plu2496 Aldehyde-alcohol dehydrogenase [includes: alcohol dehydrogenase (ADH) and acetaldehyde dehydrogenase [acetylating] (ACDH); pyruvate-formate-lyase deactivase (PFL deactivase)] from Photorhabdus luminescens subsp. laumondii TTO1
51% identity, 96% coverage
VAS14_18001 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Photobacterium angustum S14
50% identity, 95% coverage
AN479_RS20355 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Serratia marcescens
50% identity, 94% coverage
- Complete genome analysis of Serratia marcescens RSC-14: A plant growth-promoting bacterium that alleviates cadmium stress in host plants
Khan, PloS one 2017 - “...sequence of RSC-14 also contained ipd C (AN479_RS16375), which encodes indolepyruvate decarboxylase, and dha S (AN479_RS20355) which encodes indole-3-acetaldehyde dehydrogenase. Both gene products are needed for the production of IAA from tryptophan. The pathway involves tryptophan-2-monooxygenase (IaaM), which oxidizes tryptophan to indole-3-acetamide, and an indoleacetamide hydrolase...”
- “...as from indole-3-pyruvate ( Fig 5 ). Two enzymes, indolepyruvate decarboxylase (AN479_RS16375) and acetaldehyde dehydrogenase (AN479_RS20355), are involved in the conversion of tryptophan to IAA via indolepyruvate. In this pathway, tryptophan is first converted to indolepyruvate, which is subsequently converted to indole-3-acetaldehyde via indolepyruvate decarboxylase and...”
Q7NYY5 Aldehyde-alcohol dehydrogenase from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
50% identity, 95% coverage
VC2033 alcohol dehydrogenase/acetaldehyde dehydrogenase from Vibrio cholerae O1 biovar eltor str. N16961
50% identity, 95% coverage
- Transient Glycolytic Complexation of Arsenate Enhances Resistance in the Enteropathogen Vibrio cholerae
Bueno, mBio 2022 - “...interacting proteins related to energy-generating pathways are labeled in blue. PflB, VC1866 formate acetyltransferase; AdhE, VC2033 alcohol dehydrogenase/acetaldehyde dehydrogenase; HemN, VC0116 oxygen-independent coproporphyrinogen III oxidase; Icd, VC1141 isocitrate dehydrogenase; FrdA, VC2656 fumarate reductase; IspH, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase; AceF, VC2413 pyruvate dehydrogenase, E2 component; UbiE, VC0083 ubiquinone/menaquinone...”
- Identification of the TcpP-binding site in the toxT promoter of Vibrio cholerae and the role of ToxR in TcpP-mediated activation
Goss, Infection and immunity 2010 - “...toxT PROMOTER VC1865 (encoding a hypothetical protein), VC2033 (encoding alcohol dehydrogenase), and VC2368 (fexA/arcA). If we change the consensus binding site...”
- “...such a site upstream of the 5 end of the VC2033 coding strand, suggesting that it may in fact be directly regulated by TcpP. This preferred TcpP-binding site is...”
- Determination of the transcriptome of Vibrio cholerae during intraintestinal growth and midexponential phase in vitro
Xu, Proceedings of the National Academy of Sciences of the United States of America 2003 - “...and primers specific for V. cholerae genes VC2187, VC2033, VCA0933, VC0844, VC0769, and VCA0853 (8). Control PCR reactions were performed by using chromosomal...”
- “...specific for selected V. cholerae genes (VC2187, VC2033, VCA0933, VC0844, VC0769, and VCA0853, encoding FlaC, alcohol dehydrogenase, cold-shock domain family...”
- Molecular characterization and transcriptional analysis of adhE2, the gene encoding the NADH-dependent aldehyde/alcohol dehydrogenase responsible for butanol production in alcohologenic cultures of Clostridium acetobutylicum ATCC 824
Fontaine, Journal of bacteriology 2002 - “...from E. coli K-12, 54.6% identity was found with VC2033 from Vibrio cholerae (18), 46.0 and 45.6% identities were found with AdhEs from the eukaryotic anaerobic...”
- “...acetobutylicum AdhE, E. coli (Ec) AdhE, V. cholerae (Vc) VC2033, G. lamblia (G1) AdhE, E. histolytica (Eh) AdhE, L. lactis (L1) AdhE and S. enterica serovar...”
SO2136, SO_2136 aldehyde-alcohol dehydrogenase from Shewanella oneidensis MR-1
50% identity, 98% coverage
AdhE / b1241 fused acetaldehyde-CoA dehydrogenase and iron-dependent alcohol dehydrogenasealdehyde/alcohol dehydrogenase AdhE (EC 1.1.1.1; EC 1.2.1.10) from Escherichia coli K-12 substr. MG1655 (see 62 papers)
adhE / P0A9Q7 fused acetaldehyde-CoA dehydrogenase and iron-dependent alcohol dehydrogenasealdehyde/alcohol dehydrogenase AdhE (EC 1.1.1.1; EC 1.2.1.10) from Escherichia coli (strain K12) (see 64 papers)
ADHE_ECOLI / P0A9Q7 Bifunctional aldehyde-alcohol dehydrogenase AdhE; Alcohol dehydrogenase E; EC 1.2.1.10; EC 1.1.1.1 from Escherichia coli (strain K12) (see 13 papers)
ADHE_ECO57 / P0A9Q8 Bifunctional aldehyde-alcohol dehydrogenase AdhE; Alcohol dehydrogenase E; EC 1.2.1.10; EC 1.1.1.1 from Escherichia coli O157:H7 (see 2 papers)
P0A9Q7 alcohol dehydrogenase (EC 1.1.1.1); acetaldehyde dehydrogenase (acetylating) (EC 1.2.1.10) from Escherichia coli (see paper)
adhE / MB|P0A9Q7 aldehyde-alcohol dehydrogenase; EC 1.1.1.1; EC 1.2.1.10 from Escherichia coli K12 (see 12 papers)
NP_309768 acetaldehyde dehydrogenase from Escherichia coli O157:H7 str. Sakai
NP_415757 fused acetaldehyde-CoA dehydrogenase and iron-dependent alcohol dehydrogenasealdehyde/alcohol dehydrogenase AdhE from Escherichia coli str. K-12 substr. MG1655
b1241 fused acetaldehyde-CoA dehydrogenase/iron-dependent alcohol dehydrogenase/pyruvate-formate lyase deactivase from Escherichia coli str. K-12 substr. MG1655
ECs1741 CoA-linked acetaldehyde dehydrogenase/iron-dependent alcohol dehydrogenase from Escherichia coli O157:H7 str. Sakai
BHW77_13055 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Escherichia coli
50% identity, 95% coverage
- function: Under fermentative conditions, catalyzes the sequential NADH- dependent reduction of acetyl-CoA to acetaldehyde and then to ethanol (PubMed:10612730, PubMed:10922373, PubMed:17280641, PubMed:2015910, PubMed:6752127). Under aerobic conditions, despite the reversibility of the two NADH-coupled reactions, wild-type E.coli cannot grow on ethanol as the sole carbon and energy source due to the down-regulation of adhE transcription and the inactivation of the enzyme by metal-catalyzed oxidation (MCO) (PubMed:10922373). Nevertheless, in the presence of oxygen, AdhE may act as a hydrogen peroxide scavenger and have a protective role against oxidative stress (PubMed:12783863).
catalytic activity: acetaldehyde + NAD(+) + CoA = acetyl-CoA + NADH + H(+) (RHEA:23288)
catalytic activity: ethanol + NAD(+) = acetaldehyde + NADH + H(+) (RHEA:25290)
catalytic activity: a primary alcohol + NAD(+) = an aldehyde + NADH + H(+) (RHEA:10736)
cofactor: Fe(2+)
subunit: Forms long filaments, called spirosomes (PubMed:31586059, PubMed:32188856, PubMed:32523125). Forms rod-like ultrastructures composed of 20-60 identical subunits (PubMed:1325457). Two monomers form a dimer in a head-to-head arm-crossing fashion through the ALDH domains (PubMed:31586059). Subsequently, two dimers form one helical pitch via the interaction of ADH domains in a tail-to-tail manner (PubMed:31586059, PubMed:32523125). These units are further assembled into spirosomes (PubMed:31586059, PubMed:32188856, PubMed:32523125). Formation of these spirosomes is required for activity (PubMed:31586059, PubMed:32188856, PubMed:32523125). Can be isolated in vitro in a wide range of oligomeric states (PubMed:31586059).
disruption phenotype: Deletion mutant cannot grow aerobically in minimal media, is extremely sensitive to oxidative stress and shows morphologic defects that are associated with deficient septum formation (PubMed:12783863). In addition, mutant displays increased levels of internal peroxides and increased protein carbonyl content (PubMed:12783863). Both acetaldehyde dehydrogenase and alcohol dehydrogenase activities are thermolabile in temperature-sensitive mutants (PubMed:6752127). - function: Under fermentative conditions, catalyzes the sequential NADH- dependent reduction of acetyl-CoA to acetaldehyde and then to ethanol (By similarity). Plays an important role in virulence and is critical for proper regulation of virulence gene expression (PubMed:24846743).
catalytic activity: acetaldehyde + NAD(+) + CoA = acetyl-CoA + NADH + H(+) (RHEA:23288)
catalytic activity: ethanol + NAD(+) = acetaldehyde + NADH + H(+) (RHEA:25290)
catalytic activity: a primary alcohol + NAD(+) = an aldehyde + NADH + H(+) (RHEA:10736)
cofactor: Fe(2+)
subunit: Forms long filaments, called spirosomes.
disruption phenotype: Deletion of the gene affects gene expression. It leads to strong expression of non-functional flagella coupled to a complete lack of the type 3 secretion system (T3SS), including the structural proteins that comprise the secretory apparatus and its effector proteins. Mutant displays a 'paralyzed' phenotype. It also results in excretion of acetate into the surrounding environment, and reduced binding to host cells, likely because it lacks the T3SS. Deletion of the gene affects colonization and clinical disease in vivo. - High-resolution structure of the alcohol dehydrogenase domain of the bifunctional bacterial enzyme AdhE.
Azmi, Acta crystallographica. Section F, Structural biology communications 2020 - GeneRIF: High-resolution structure of the alcohol dehydrogenase domain of the bifunctional bacterial enzyme AdhE.
- Filamentation of the bacterial bi-functional alcohol/aldehyde dehydrogenase AdhE is essential for substrate channeling and enzymatic regulation.
Pony, Nature communications 2020 - GeneRIF: AdhE filamentation is essential for its activity in vitro and function in vivo.
- Aldehyde-alcohol dehydrogenase forms a high-order spirosome architecture critical for its activity.
Kim, Nature communications 2019 - GeneRIF: Study presents the atomic resolution structure of AdhE from Escherichia coli K12 strain and suggests that the high-order helical structure regulates its enzymatic activity.
- Eliminating side products and increasing succinate yields in engineered strains of Escherichia coli C.
Jantama, Biotechnology and bioengineering 2008 (PubMed)- GeneRIF: Deletion of the E. coli adhE gene (together with deletions of other ferementation disruption genes) increased production of succinate
- Inactivation of E. coli pyruvate formate-lyase: role of AdhE and small molecules.
Nnyepi, Archives of biochemistry and biophysics 2007 - GeneRIF: Our results demonstrate that AdhE is not a PFL deactivating enzyme.
- Pyruvate-formate-lyase-deactivase and acetyl-CoA reductase activities of Escherichia coli reside on a polymeric protein particle encoded by adhE.
Kessler, FEBS letters 1991 (PubMed)- GeneRIF: N-terminus verified by Edman degradation on mature peptide
- Convergent reductive evolution in bee-associated lactic acid bacteria
Pontes, Applied and environmental microbiology 2024 - “...For that, the reviewed protein of AdhE for Escherichia coli was recovered from UniProt ( P0A9Q7 ), and OhyA for Lactobacillus amylolyticus ( WP_127345688 ) was used as query for a BLASTp search in the NCBI refseq database. Hits with an e value lower than 0.001...”
- Systems biology approach for enhancing limonene yield by re-engineering Escherichia coli
Khanijou, NPJ systems biology and applications 2024 - “...method as described previously 106 was used to delete ldhA (UniProt P52643) and adhE (UniProt P0A9Q7) genes from the E. coli MG1655 strain, resulting in LDH and ALDH-ADH knockouts, respectively. The ldhA and adhE regions of three successfully knockout strains were PCR amplified and thereafter sequenced...”
- Convergent reductive evolution in bee-associated lactic acid bacteria.
Pontes, bioRxiv : the preprint server for biology 2024 - “...constructed. For that the reviewed protein of AdhE for Escherichia coli was recovered from UniProt (P0A9Q7) and OhyA for Lactobacillus amylolyticus (WP_127345688) were used as query for a BLASTp search in NCBI refseq database. Hits with an e-value lower than 0.001 were retrieved, up to a...”
- Enterocloster alcoholdehydrogenati sp. nov., a Novel Bacterial Species Isolated from the Feces of a Patient with Alcoholism
Oikawa, Current microbiology 2023 - “...such as a putative alcohol dehydrogenase with similarity to AdhE of Escherichia coli (UniProt code, P0A9Q7), a putative zinc-type alcohol dehydrogenase with similarity to YjmD of Bacillus subtilis (UniProt code, O35045), and a putative catalase with similarity to a catalase of Lactiplantibacillus plantarum (basonym: Lactobacillus plantarum...”
- Surface proteins of Shiga toxin-producing Escherichia coli mediate association with milk fat globules in raw milk
Bagel, Frontiers in microbiology 2023 - “...50S ribosomal protein L5 3 Cytoplasmic + + 1,23 (6,64E03) 6,64 (1,00E17) 6,64 (1,00E17) A0A7I6R742 P0A9Q7 Bifunctional aldehyde-alcohol dehydrogenase AdhE 2 Cytoplasmic + 6,64 (1,00E17) 6,64 (1,00E17) Q8XEB8 Isochorismatase domain-containing protein 1 Cytoplasmic + + 6,64 (1,00E17) 2,33 (1,00E17) 6,64 (1,00E17) F4TL18 DNA-directed RNA polymerase subunit...”
- Functional Prediction of Biological Profile During Eutrophication in Marine Environment
Sbaoui, Bioinformatics and biology insights 2022 - “...B and 2-methylisocitrate dehydratase AcnC P0ACI6 DNA-binding transcriptional dual regulator ACS P27550 Acetyl-CoA synthetase AdhE P0A9Q7 Fused acetaldehyde-CoA dehydrogenase and iron-dependent alcohol dehydrogenase Agaz P0C8K0 Tagatose 6-phosphate aldolase 1, subunit Kbaz AmoA Q04507/A0A5E9SRA6 Ammonia monooxygenase alpha subunit AppY P05052 DLP12 prophage; DNA-binding transcriptional activator AroD P05194...”
- Early and specific targeted mass spectrometry-based identification of bacteria in endotracheal aspirates of patients suspected with ventilator-associated pneumonia
Bardet, European journal of clinical microbiology & infectious diseases : official publication of the European Society of Clinical Microbiology 2021 - “...time: 15.56min). * 2 E. coli VVAVGDQVEK: (P75691 UniProtKB accession number; retention time: 11.24min); DYVEGETAAK (P0A9Q7 UniProtKB accession number; retention time: 9.76min); WNGVTVTPK (P0ADU5 UniProtKB accession number; retention time: 13.99min). * 3 H. influenzae : YAYVTLGNK (P43839 UniProtKB accession number; retention time: 14.71min); VQFEVLHSDK (A0A0D0IG76 UniProtKB...”
- Comparative Analysis of Outer Membrane Vesicle Isolation Methods With an Escherichia coli tolA Mutant Reveals a Hypervesiculating Phenotype With Outer-Inner Membrane Vesicle Content
Reimer, Frontiers in microbiology 2021 - “...P06959 aceF Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex tolA 0.015 INF Increased in tolA P0A9Q7 adhE Aldehyde-alcohol dehydrogenase tolA <0.00010 78 Increased in tolA P0ABB0 atpA ATP synthase subunit alpha tolA 0.011 INF Increased in tolA P0ABD3 bfr Bacterioferritin WT <0.00010 0 Increased in WT...”
- More
- Pre-existing antibodies targeting a linear epitope on SARS-CoV-2 S2 cross-reacted with commensal gut bacteria and shaped vaccine induced immunity
Jia, 2021 - FastKnock: an efficient next-generation approach to identify all knockout strategies for strain optimization
Hassani, Microbial cell factories 2024 - “...by deleting one reaction, ADHEr, which is knocked out by the deletion of the gene b1241. Consequently, the deletion of the b1241 gene also causes the deletion of the LCADi_copy2 reaction. In this situation, the growth rate is 0.16 (h 1 ) as shown in the...”
- “...(h 1 ) Deleted genes Co-knockout reactions min max Single ADHEr 0.16 5.11 9.50 1.41E-2 b1241 LCADi_copy2 Double ADHEr, LDH_D 0.15 8.08 9.51 1.43E-2 b1241, b2133, b1380 LCADi_copy2 Triple ADHEr, LDH_D, PFL 0.12 11.08 12.73 1.53E-2 b1241, b2133, b1380, b3114, b0902, b3951 LCADi_copy, OBTFL Quadruple ADHEr,...”
- RpoS-Regulated Genes and Phenotypes in the Phytopathogenic Bacterium Pectobacterium atrosepticum
Petrova, International journal of molecular sciences 2023 - “...ECA1867 b1676 pyruvate kinase General metabolism sodC ECA2211 b1646 superoxide dismutase (Cu-Zn) Stress adhE ECA2326 b1241 fused acetaldehyde-CoA dehydrogenase and iron-dependent alcohol dehydrogenasealdehyde/alcohol dehydrogenase General metabolism, stress elaB ECA3015 b2266 tail-anchored inner membrane protein Stress frdA ECA3969 b4154 fumarate reductase flavoprotein subunit General metabolism frdB ECA3970...”
- A systems approach discovers the role and characteristics of seven LysR type transcription factors in Escherichia coli
Rodionova, Scientific reports 2022 - “...ABC transporter periplasmic binding protein 402.0 5.7 b2997 hybO Hydrogenase 2 small subunit 245.6 5.7 b1241 adhE aldehyde-alcohol dehydrogenase 8441.5 5.7 b1925 fliS Flagellar biosynthesis protein FliS 134.0 5.6 b1587 ynfE Putative selenate reductase YnfE 250.8 5.6 b1083 flgL Flagellar hook-filament junction protein 2 3080.4 5.6...”
- Metabolic shift of Escherichia coli under salt stress in the presence of glycine betaine
Metris, Applied and environmental microbiology 2014 - “...Protein kinase Conserved hypothetical protein Putative selenate reductase b1241 b1241 b4260 b3556 b2414 b0031 b2095 b2095 b0809 b3213 b2579 b1237 b1237 b3671 2...”
- A comparison of key aspects of gene regulation in Streptomyces coelicolor and Escherichia coli using nucleotide-resolution transcription maps produced in parallel by global and differential RNA sequencing
Romero, Molecular microbiology 2014 - “...views of the E. coli rpsT (b0023), ompA (b0957), eno (b2779), pnp (b3165) and adhE (b1241) respectively. The tracks from top to bottom show the genome positions, gRNA-seq reads, gene locations and differential RNA-seq reads (in the absence of TAP treatment). The labelled RNase E sites...”
- 18th Congress of the European Hematology Association, Stockholm, Sweden, June 13–16, 2013
, Haematologica 2013 - Transcription, translation, and the evolution of specialists and generalists
Zhong, Molecular biology and evolution 2009 - “...Methylgalactoside b-Number b0308 b0473 b0532 b1023 b1071 b1077 b1241 b1272 b1348 b1972 b1973 b2742 b2761 b3296 b3591 b3829 b3890 b4104 b4286 b4347 log2 LU/MG...”
- Global analysis of extracytoplasmic stress signaling in Escherichia coli
Bury-Moné, PLoS genetics 2009 - “...) hdhA b1619 7-alpha-hydroxysteroid dehydrogenase/lipid, steroid metabolism, belongs to the S regulon 2.0 adhE W b1241 Iron dependent aldehyde-alcohol dehydrogenase, pyruvate-formate lyase-deactivase 2.0 ygaW b2670 Predicted inner membrane protein 2.0 gcvP gcvH gcvT W b2903-5 GcvH: lipoylprotein aminomethyltransferase ; GcvT: tetrahydrofolate dependent subunit/Glycine cleavage complex -;...”
- More
- Global transcriptional response of Escherichia coli O157:H7 to growth transitions in glucose minimal medium
Bergholz, BMC microbiology 2007 - “...narK nitrite extrusion protein 2.98 6 ECs1729 narG nitrate reductase 1, alpha subunit 2.25 4 ECs1741 adhE CoA-linked acetaldehyde dehydrogenase 2.50 6 ECs1756 yciD putative outer membrane protein 4.15 4 ECs1875 ycjL probable amidotransferase subunit -2.28 2 ECs2027 ydcI putative transcriptional regulator LYSR-type -2.41 2 ECs2078...”
- “...ECs0987 focA -3.38 1.11 6 ECs0994 rpsA -3.78 0.66 1 ECs1261 putP 2.80 -0.92 10 ECs1741 adhE -4.01 1.17 6 ECs1744 oppB -2.05 1.36 7 ECs1772 O157 -0.68 2.22 2 ECs2383 pykF -2.42 1.49 un ECs2387 sufS 0.71 2.17 2 ECs2481 ydjH -2.44 0.84 6 ECs2482...”
- Comparative genomics reveals structural and functional features specific to the genome of a foodborne Escherichia coli O157:H7
Sharma, BMC genomics 2019 - “...1717 2.6 3 2,428,4422,431,075 BHW77_12620 and BHW77_12650 55.88 NC_011357 11/Enterobacteria phage YYZ-2008 113.4 31 2,514,1932,627,682 BHW77_13055 and BHW77_13845 51.50 NC_011356 12/Enterobacteria phage BP-4795 60 29 2,800,1432,860,221 BHW77_14595 and BHW77_14980 50.25 NC_004813 13/Enterobacteria phage BP-4795 57.4 32 2,967,2683,024,670 BHW77_15525 and BHW77_15920 50.94 NC_004813 14/Enterobacteria phage P88 24.8...”
ECOLIN_07285 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Escherichia coli Nissle 1917
UTI89_C1438 CoA-linked acetaldehyde dehydrogenase from Escherichia coli UTI89
50% identity, 95% coverage
Z2016 CoA-linked acetaldehyde dehydrogenase and iron-dependent alcohol dehydrogenase; pyruvate-formate-lyase deactivase from Escherichia coli O157:H7 EDL933
50% identity, 95% coverage
7bvpA / P0A9Q7 Adhe spirosome in extended conformation (see paper)
50% identity, 97% coverage
- Ligands: nicotinamide-adenine-dinucleotide; zinc ion (7bvpA)
swp_2623 Iron-containing alcohol dehydrogenase from Shewanella piezotolerans WP3
49% identity, 97% coverage
- Condition-Specific Molecular Network Analysis Revealed That Flagellar Proteins Are Involved in Electron Transfer Processes of Shewanella piezotolerans WP3
Ding, Genetics research 2021 - “...various environmental conditions. Rank Cold shock Heat shock High pressure Salt shock 1 swp_5124 swp_3803 swp_2623 swp_0485 2 swp_5105 swp_2388 swp_4312 swp_0361 3 swp_1504 swp_1379 swp_5025 swp_2579 4 swp_5095 swp_3139 swp_4352 swp_4934 5 swp_5110 swp_2213 swp_0430 swp_2897 6 swp_5111 swp_2216 swp_2139 swp_0501 7 swp_1508 swp_3758 swp_0854...”
- “...0.50 1.42 E 02 swp_4653, swp_4654, swp_4652, swp_4657, swp_4655 7 7 0.52 2.19 E 02 swp_2623, swp_2495, swp_4933, swp_4301, swp_4936, swp_4935, swp_4940 8 4 0.50 2.89 E 02 Purine metabolism swp_1361, swp_4724, swp_2972, swp_2621 9 5 0.50 4.13 E 02 NrfD family swp_4653, swp_4654, swp_4652, swp_4655,...”
L2164_05320 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Pectobacterium brasiliense
49% identity, 95% coverage
PAJ_1411 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Pantoea ananatis AJ13355
49% identity, 94% coverage
c1705 Aldehyde-alcohol dehydrogenase from Escherichia coli CFT073
50% identity, 95% coverage
ECA2326 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Pectobacterium atrosepticum SCRI1043
ECA2326 aldehyde-alcohol dehydrogenase [includes: alcohol dehydrogenase and acetaldehyde dehydrogenase, and pyruvate-formate-lyase deactivase from Erwinia carotovora subsp. atroseptica SCRI1043
49% identity, 95% coverage
- RpoS-Regulated Genes and Phenotypes in the Phytopathogenic Bacterium Pectobacterium atrosepticum
Petrova, International journal of molecular sciences 2023 - “...pykF ECA1867 b1676 pyruvate kinase General metabolism sodC ECA2211 b1646 superoxide dismutase (Cu-Zn) Stress adhE ECA2326 b1241 fused acetaldehyde-CoA dehydrogenase and iron-dependent alcohol dehydrogenasealdehyde/alcohol dehydrogenase General metabolism, stress elaB ECA3015 b2266 tail-anchored inner membrane protein Stress frdA ECA3969 b4154 fumarate reductase flavoprotein subunit General metabolism frdB...”
Q1RS84 alcohol dehydrogenase (EC 1.1.1.1); acetaldehyde dehydrogenase (acetylating) (EC 1.2.1.10) from Chlamydomonas reinhardtii (see paper)
50% identity, 89% coverage
KPN_02199 CoA-linked acetaldehyde dehydrogenase and iron-dependent alcohol dehydrogenase; pyruvate-formate-lyase deactivase from Klebsiella pneumoniae subsp. pneumoniae MGH 78578
50% identity, 95% coverage
- Identification of antigenic proteins of the nosocomial pathogen Klebsiella pneumoniae
Hoppe, PloS one 2014 - “...1.310.27 KPN_01584 [A6T8U4] Hypothetical protein 113 12.9 1.900.36 KPN_01784 [A6T9E4] Phosphoglycerate mutase 206 22.8 0.960.21 KPN_02199 [A6TAK6] CoA-linked acetaldehyde dehydrogenase and iron-dependent alcohol dehydrogenase; pyruvate-formate-lyase deactivase 891 95.8 2.160.39 KPN_02202 [A6TAK9] Glucose-1-phosphate uridylyltransferase 300 32.6 1.690.56 KPN_02919 [A6TCK4] Putative yhbH sigma 54 modulator 109 12.3 1.390.38...”
- “...signals than OmpA, the used positive reference. The highest mean Q value was obtained for KPN_02199, a CoA-linked acetaldehyde dehydrogenase and iron-dependent alcohol dehydrogenase; pyruvate-formate-lyase deactivase with 2.160.39. However, as this protein is highly conserved within all bacteria, it was not considered for further analyses regarding...”
LKW31_09010 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Pantoea agglomerans
50% identity, 94% coverage
STM1749 iron-dependent alcohol dehydrogenase of the multifunctional alcohol dehydrogenase AdhE from Salmonella typhimurium LT2
A0A0F6B241 Aldehyde-alcohol dehydrogenase from Salmonella typhimurium (strain 14028s / SGSC 2262)
SPC_1980 alcohol dehydrogenase from Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
50% identity, 95% coverage
- Deletions in the pyruvate pathway of Salmonella Typhimurium alter SPI1-mediated gene expression and infectivity
Abernathy, Journal of animal science and biotechnology 2013 - “...strains, pflB::kan ( S. Typhimurium gene number STM0973) and adhE::kan ( S. Typhimurium gene number STM1749), were created by the lambda red recombination method with adaptations as described by Santiviago et.al. [ 48 ]. Gene-specific primers used for the creation of each isolate are listed in...”
- “...AATGAAAAGTTAGCCACAGTGCAGGCT GGAGCTGCTTC TTTCAGTCAAACCCATTACAT GGTCTGCGTGAAGGTACGAGT AATCATATGAATATCCTCCTTAG STM0973 Lambda red adhE TATCAGGAGAGCATTATGGCTGTTACT AATGTCGCTGAACTTAACGTGCAGGCT GGAGCTGCTTC AAAACAGATAACGAATTAAGC GGATTTTTTCGCTTTTTTCTC TGCCATATGAATATCCTCCTTAG STM1749 16S rRNA AGGCCTTCGGGTTGTAAAGT GTTAGCCGGTGCTTCTTCTG [ 49 ] qPCR hilA ATAGCAAACTCCCGACGATG ATTAAGGCGACAGAGCTGG [ 50 ] hilC CTCACCTCTTCAGCGGCCAGT CACCCGCAAATGGTCACAGGCT STM2867 hilD GGTAGTTAACGTGACGCTTG GATCTTCTGCGCTTTCTCTG [ 50 ] invC TCGGTCGATCGCTGCAA CCCTGGTCGCGAAAATATTC STM2894 invE CGAATGACGCCAGCTGTTC...”
- Host restriction of Salmonella enterica serotype Typhimurium pigeon isolates does not correlate with loss of discrete genes
Andrews-Polymenis, Journal of bacteriology 2004 - “...R23 R24 R25 R26 R27 STM1190 STM1491 STM1666 STM2166 STM1749 STM10011 STM10022 1974 1975 1979 1990 1996 2000 2000 DT204 DT204 DT204 DT204 DT204 DT204 DT204 Human...”
- Antioxidant and antibacterial activity of Apis laboriosa honey against Salmonella enterica serovar Typhimurium
Tan, Frontiers in nutrition 2023 - “...analysis is shown in Figure 5 . The top 4 interacting proteins were aldehyde-alcohol dehydrogenase (A0A0F6B241, upregulated, p =0.000158), putative pyruvate-flavodoxin oxidoreductase (A0A0F6B1S9, downregulated, p =0.012980), N-acetyl glucosamine-specific PTS system components IIABC (A0A0F6AYI0, downregulated, p =0.014904) and malic enzyme (A0A0F6B4M2, downregulated, p =0.006444). Figure 5 Network...”
- Antibacterial Components and Modes of the Methanol-Phase Extract from Commelina communis Linn
Liu, Plants (Basel, Switzerland) 2023 - “...0.417 Glucose-6-phosphate isomerase SPC_1226 2.146 Glucose-specific PTS system enzyme IIA component SPC_4187 2.296 Triosephosphate isomerase SPC_1980 2.76 Alcohol dehydrogenase SPC_2451 3.023 Glyceraldehyde-3-phosphate dehydrogenase SPC_3111 3.382 6-phospho-beta-glucosidase SPC_2543 5.68 PTS system glucose-specific IIBC component Oxidative phosphorylation SPC_0730 0.057 Succinate dehydrogenase cytochrome b556 small membrane subunit SPC_1381 0.345...”
STY1302 alcohol dehydrogenase from Salmonella enterica subsp. enterica serovar Typhi str. CT18
Q8Z7F1 Aldehyde-alcohol dehydrogenase from Salmonella typhi
50% identity, 95% coverage
L910_4642, L911_3405 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Vibrio fluvialis PG41
50% identity, 94% coverage
- Evidence of a new metabolic capacity in an emerging diarrheal pathogen: lessons from the draft genomes of Vibrio fluvialis strains PG41 and I21563
Khatri, Gut pathogens 2013 - “...L911_0585 14 123131 123973 Ethanolamine permease L910_3172 3 304317 305711 L911_0586 14 124004 125398 EutE L910_4642 9 2285 4987 L911_3405 50 27410 24708 EutP L910_1582 15 173979 175775 L911_2069 30 21335 19671 Vibrio fluvialis utilizes ethanolamine as an energy source As evident from the preceding section,...”
- “...Ethanolamine permease L910_3172 3 304317 305711 L911_0586 14 124004 125398 EutE L910_4642 9 2285 4987 L911_3405 50 27410 24708 EutP L910_1582 15 173979 175775 L911_2069 30 21335 19671 Vibrio fluvialis utilizes ethanolamine as an energy source As evident from the preceding section, the genome of Vibrio...”
FZF21_20165 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Enterobacter sp. LU1
50% identity, 95% coverage
RPC_4481 iron-containing alcohol dehydrogenase from Rhodopseudomonas palustris BisB18
49% identity, 96% coverage
Entcl_2072 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from [Enterobacter] lignolyticus SCF1
49% identity, 95% coverage
- Multi-time series RNA-seq analysis of Enterobacter lignolyticus SCF1 during growth in lignin-amended medium
Orellana, PloS one 2017 - “...EC 2.7.2.1, encoded by Entcl_0583, Entcl_1740, and Entcl_1433; (23) Acetaldehyde dehydrogenase, EC 1.2.1.10, encoded by Entcl_2072, and Entcl_1745; (24) Alcohol dehydrogenase, EC 1.1.1.1, encoded by Entcl_2072, Entcl_0739, Entcl_1314, Entcl_1745, Entcl_3458, and Entcl_4294; (25) Xylose Isomerase, EC 5.3.1.5, encoded by Entcl_0177; (26) Xylulose kinase, EC 2.7.1.17, encoded...”
BJD94_06220 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Vibrio vulnificus Env1
49% identity, 95% coverage
- Loss of the Acetate Switch in Vibrio vulnificus Enhances Predation Defense against Tetrahymena pyriformis
Rasheedkhan, Applied and environmental microbiology 2022 - “...Acetate kinase, ackA Acetyl-CoA to acetate BJD94_20925 2.391 0.0314181 Acetate kinase, ackA Acetyl-CoA to acetate BJD94_06220 1.6943 1.142E36 Alcohol dehydrogenase 3B acetaldehyde dehydrogenase, adh/aldh Acetyl-CoA to ethanol to acetaldehyde to acetate Acetate excretion in Gammaproteobacteria such as Vibrio spp. and Escherichia coli follows two different pathways:...”
- “...through pyruvate fermentation. Moreover, the upregulation of genes associated with alcohol/acetaldehyde dehydrogenase ( adh/aldH ) (BJD94_06220) suggested that acetate accumulates through conversion of acetyl-CoA to ethanol and acetaldehyde and contributes to replenishing NAD + from NADH. In addition to decarboxylation of pyruvate, Pfl also catalyzes pyruvate...”
A0KLH4 Aldehyde-alcohol dehydrogenase from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
AHA_2616 aldehyde-alcohol dehydrogenase from Aeromonas hydrophila subsp. hydrophila ATCC 7966
50% identity, 95% coverage
- Quantitative Proteomics Analysis Reveals the Effect of a MarR Family Transcriptional Regulator AHA_2124 on Aeromonas hydrophila
Li, Biology 2023 - “...the top 20 hub proteins are A0KEL7 (gene ID: AHA_0149 ), A0KID3 ( AHA_1496 ), A0KLH4 ( AHA_2616 ), A0KLK7 ( AHA_2649 ), A0KN49 ( AHA_3209 ), EutE, FrdA, Icd, IlvB-2, LeuA-1, LeuB, PpsA, RnpA, RplF, RpmA, RpmG, RpmH, RpsB, RpsF, and YfiA-1, and most of...”
- The Lysine Acetylation Modification in the Porin Aha1 of Aeromonas hydrophila Regulates the Uptake of Multidrug Antibiotics
Zhang, Molecular & cellular proteomics : MCP 2022 - “...between both comparisons, and 17 of them were downregulated, with three proteins (A0KQ46, A0KLY0, and A0KLH4) being both upregulated in whole-cell and Kac-altered proteins ( Fig.2 B ). Interestingly, there was only one protein (SapD) upregulated in Kac proteins and downregulated in whole-cell protein, and one...”
- Quantitative Proteomics Analysis Reveals the Effect of a MarR Family Transcriptional Regulator AHA_2124 on Aeromonas hydrophila
Li, Biology 2023 - “...20 hub proteins are A0KEL7 (gene ID: AHA_0149 ), A0KID3 ( AHA_1496 ), A0KLH4 ( AHA_2616 ), A0KLK7 ( AHA_2649 ), A0KN49 ( AHA_3209 ), EutE, FrdA, Icd, IlvB-2, LeuA-1, LeuB, PpsA, RnpA, RplF, RpmA, RpmG, RpmH, RpsB, RpsF, and YfiA-1, and most of them were...”
VP2121 alcohol dehydrogenase/acetaldehyde dehydrogenase from Vibrio parahaemolyticus RIMD 2210633
Q87MW0 Aldehyde-alcohol dehydrogenase from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
49% identity, 94% coverage
- Comparative Proteomics and Secretomics Revealed Virulence and Antibiotic Resistance-Associated Factors in Vibrio parahaemolyticus Recovered From Commonly Consumed Aquatic Products
Zhu, Frontiers in microbiology 2020 - “...no. Protein Gene MW (Da) pI Sequence coverage (%) Putative function P1 Q87MW0 Aldehyde-alcohol dehydrogenase VP2121 97,121.96 5.73 26.78 Acetaldehyde dehydrogenase (acetylating) activity, alcohol dehydrogenase (NAD+) activity, metal ion binding, alcohol metabolic process, carbon utilization P2 S5J2K3 Peptide ABC TSBP M634_12650 63,520.87 5.35 3.70 Transmembrane transport,...”
- “...activity, sulfur transferase activity, tRNA binding, tRNA modification, cytoplasm CHN-N4-18/TSB medium G2-1 Q87MW0 Aldehyde-alcohol dehydrogenase VP2121 97,121.96 5.73 26.78 Acetaldehyde dehydrogenase (acetylating) activity, alcohol dehydrogenase (NAD+) activity, metal ion binding, alcohol metabolic process, carbon utilization CHN-N8-5/ M. veneriformis G2-2 A0A0N0CBA6 Uncharacterized protein ACX03_16865 33,357.07 4.39 6.35...”
- Comparative Proteomics and Secretomics Revealed Virulence and Antibiotic Resistance-Associated Factors in Vibrio parahaemolyticus Recovered From Commonly Consumed Aquatic Products
Zhu, Frontiers in microbiology 2020 - “...spot no. Uniprot no. Protein Gene MW (Da) pI Sequence coverage (%) Putative function P1 Q87MW0 Aldehyde-alcohol dehydrogenase VP2121 97,121.96 5.73 26.78 Acetaldehyde dehydrogenase (acetylating) activity, alcohol dehydrogenase (NAD+) activity, metal ion binding, alcohol metabolic process, carbon utilization P2 S5J2K3 Peptide ABC TSBP M634_12650 63,520.87 5.35...”
- “...ATP binding, methyltransferase activity, sulfur transferase activity, tRNA binding, tRNA modification, cytoplasm CHN-N4-18/TSB medium G2-1 Q87MW0 Aldehyde-alcohol dehydrogenase VP2121 97,121.96 5.73 26.78 Acetaldehyde dehydrogenase (acetylating) activity, alcohol dehydrogenase (NAD+) activity, metal ion binding, alcohol metabolic process, carbon utilization CHN-N8-5/ M. veneriformis G2-2 A0A0N0CBA6 Uncharacterized protein ACX03_16865...”
A4ECL0 Aldehyde-alcohol dehydrogenase from Collinsella aerofaciens (strain ATCC 25986 / DSM 3979 / JCM 10188 / KCTC 3647 / NCTC 11838 / VPI 1003)
51% identity, 97% coverage
CSV91_03400 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Collinsella aerofaciens
51% identity, 97% coverage
YP_193379 alcohol-acetaldehyde dehydrogenase from Lactobacillus acidophilus NCFM
49% identity, 97% coverage
YPTB2103 aldehyde-alcohol dehydrogenase from Yersinia pseudotuberculosis IP 32953
YPO2180 aldehyde-alcohol dehydrogenase from Yersinia pestis CO92
49% identity, 95% coverage
- Growth of Yersinia pseudotuberculosis in human plasma: impacts on virulence and metabolic gene expression
Rosso, BMC microbiology 2008 - “...(< 0.001) 1.322 (0.185) YPTB3762 YPO0138 pck putative phosphoenolpyruvate carboxykinase [ATP] 0.395 (0.001) 1.213 (0.460) YPTB2103 YPO2180 adhE, ana putative aldehyde-alcohol dehydrogenase 2.116 (0.001) 3.383 (< 0.001) YPTB0460 YPO3516 mdh putative malate dehydrogenase 0.665 (0.010) 0.394 (< 0.001) YPTB0796 YPO3335 fumA, fumB putative fumarase A fumarate...”
- “...0.6 (0.008) YPTB2017 YPO2035 hypothetical protein 1.694 (0.045) YPTB2089 YPO2163 putative nitroreductase 2.095 (< 0.001) YPTB2103 (adhE) YPO2180 aldehyde-alcohol dehydrogenase 2.115 (< 0.001) YPTB2165 YPO2244 Fe-S binding NADH dehydrog. (pseudogene. F/S) 2.157 (< 0.001) YPTB2224 (pntB) YPO2302 NAD(P) transhydrogenase subunit beta 1.502 (0.037) YPTB2248 (ldhA) YPO2329...”
- Growth of Yersinia pseudotuberculosis in human plasma: impacts on virulence and metabolic gene expression
Rosso, BMC microbiology 2008 - “...0.001) 1.322 (0.185) YPTB3762 YPO0138 pck putative phosphoenolpyruvate carboxykinase [ATP] 0.395 (0.001) 1.213 (0.460) YPTB2103 YPO2180 adhE, ana putative aldehyde-alcohol dehydrogenase 2.116 (0.001) 3.383 (< 0.001) YPTB0460 YPO3516 mdh putative malate dehydrogenase 0.665 (0.010) 0.394 (< 0.001) YPTB0796 YPO3335 fumA, fumB putative fumarase A fumarate hydratase...”
- “...YPTB2017 YPO2035 hypothetical protein 1.694 (0.045) YPTB2089 YPO2163 putative nitroreductase 2.095 (< 0.001) YPTB2103 (adhE) YPO2180 aldehyde-alcohol dehydrogenase 2.115 (< 0.001) YPTB2165 YPO2244 Fe-S binding NADH dehydrog. (pseudogene. F/S) 2.157 (< 0.001) YPTB2224 (pntB) YPO2302 NAD(P) transhydrogenase subunit beta 1.502 (0.037) YPTB2248 (ldhA) YPO2329 D-lactate dehydrogenase...”
Cphy_3925 iron-containing alcohol dehydrogenase from Clostridium phytofermentans ISDg
50% identity, 98% coverage
T285_RS07350 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Lactobacillus johnsonii N6.2
48% identity, 98% coverage
- Identification of Biomarkers for Systemic Distribution of Nanovesicles From Lactobacillus johnsonii N6.2
Harrison, Frontiers in immunology 2021 - “...38.42 6.29 4.48 0.003 0.006 T285_RS07040 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B 27.22 9.02 7.38 1.44 0.030 T285_RS07350 Bifunctional acetaldehyde-CoA/alcohol dehydrogenase 40.53 4.78 15.62 11.33 0.024 T285_RS08820 6-phosphogluconate dehydrogenase, decarboxylating 15.50 4.77 1.49 1.05 0.015 T285_RS08830 tRNA uridine 5-carboxymethylaminomethyl modification enzyme (MnmG) 10.39 0.32 4.04 1.06 0.003 The...”
Awo_c06310 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Acetobacterium woodii DSM 1030
49% identity, 96% coverage
Blon_2241 iron-containing alcohol dehydrogenase from Bifidobacterium longum subsp. infantis ATCC 15697
50% identity, 93% coverage
BKKJ1_0341 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Bifidobacterium catenulatum subsp. kashiwanohense
50% identity, 93% coverage
- Metabolism of the predominant human milk oligosaccharide fucosyllactose by an infant gut commensal
James, Scientific reports 2019 - “...BKKJ1_0338 hypothetical protein 27.69 BKKJ1_0339 BKKJ1_0339 xylitol (sorbitol) dehydrogenase 34.61 BKKJ1_0340 BKKJ1_0340 transcriptional regulator 36.34 BKKJ1_0341 BKKJ1_0341 aldehyde-alcohol dehydrogenase 2 22.03 BKKJ1_0429 fumG L-1,2-propanediol oxidoreductase 5.90 BKKJ1_2066 lacS galactoside symporter 5.35 BKKJ1_2067 lacA beta-galactosidase 6.47 BKKJ1_2068 lacR Truncated LacI-type transcriptional regulator BKKJ1_2069 fumA1 GH95 alpha-1 3/4-fucosidase...”
T0PGH4 Alcohol dehydrogenase iron-type/glycerol dehydrogenase GldA domain-containing protein from Clostridium sp. BL8
68% identity, 67% coverage
BLJ_1756 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Bifidobacterium longum subsp. longum JDM301
50% identity, 93% coverage
BL1575 Adh2 from Bifidobacterium longum NCC2705
50% identity, 93% coverage
BBMN68_1612 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Bifidobacterium longum subsp. longum BBMN68
50% identity, 93% coverage
adhE / P33744 alcohol/aldehyde dehydrogenase (EC 1.1.1.1; EC 1.2.1.10; EC 1.2.1.57) from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see 4 papers)
ADHE_CLOAB / P33744 Aldehyde-alcohol dehydrogenase; AAD; EC 1.1.1.1; EC 1.2.1.3 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W) (see paper)
aad / GB|AAD04638.1 aldehyde-alcohol dehydrogenase; EC 1.1.1.1; EC 1.2.1.10 from Clostridium acetobutylicum ATCC 824 (see paper)
aad / AAD04638.1 aldehyde-alcohol dehydrogenase from Clostridium acetobutylicum (see 2 papers)
CAP0162 Aldehyde dehydrogenase (NAD+) from Clostridium acetobutylicum ATCC 824
CA_P0162 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Clostridium acetobutylicum ATCC 824
50% identity, 98% coverage
- function: Has both aldehyde and alcohol dehydrogenase activities. Can use acetaldehyde, butyraldehyde, butanol and ethanol.
catalytic activity: a primary alcohol + NAD(+) = an aldehyde + NADH + H(+) (RHEA:10736)
catalytic activity: a secondary alcohol + NAD(+) = a ketone + NADH + H(+) (RHEA:10740)
catalytic activity: an aldehyde + NAD(+) + H2O = a carboxylate + NADH + 2 H(+) (RHEA:16185) - The ald gene, encoding a coenzyme A-acylating aldehyde dehydrogenase, distinguishes Clostridium beijerinckii and two other solvent-producing clostridia from Clostridium acetobutylicum
Toth, Applied and environmental microbiology 1999 - “...Entamoeba histolytica (Q24803 and S53319), C. acetobutylicum (P33744 and A49346), Lactococcus lactis (CAA04467), and Giardia intestinalis (U93353) and the...”
- “...Accession no. L06902 AAA80209 Q24803 U93353 P38947 P33744 P17547 CAA04467 P11883 a Abbreviations: Aad, AdhE, and Adh2, aldehyde-alcohol dehydrogenases; EutE,...”
- The Small RNA sr8384 Is a Crucial Regulator of Cell Growth in Solventogenic Clostridia
Yang, Applied and environmental microbiology 2020 (secret) - Transcription factors and genetic circuits orchestrating the complex, multilayered response of Clostridium acetobutylicum to butanol and butyrate stress
Wang, BMC systems biology 2013 - “...CAC2873, and adhE2 ( CAP0035), the fusion-protein aldehyde/alcohol dehydrogenase, which is highly homologous to adhE1 (CAP0162). In addition, based on orthology to target genes in Rex regulons from RegPrecise and identification of putative Rex binding sites (Matrix Scan with the Rex-binding DNA motif in Clostridiales from...”
- Global transcriptional changes of Clostridium acetobutylicum cultures with increased butanol:acetone ratios
Hönicke, New biotechnology 2012 (PubMed)- “...substitution of adhE1 (CAP0162) by adhE2. 0 false false http://api.elsevier.com/content/object/eid/1-s2.0-S1871678412000027-gr1.jpg?httpAccept=%2A%2F%2A...”
- “...buk , CAC3075; ptb , CAC3076; bcd , CAC2711; adhE1 , CAP0162; adhE2 , CAP0035; bdhA , CAC3299; bdhB , CAC3298; Fd O , oxidized ferredoxin; Fd R , reduced...”
- An improved kinetic model for the acetone-butanol-ethanol pathway of Clostridium acetobutylicum and model-based perturbation analysis
Li, BMC systems biology 2011 - “...[ 16 - 19 ]. There are many important solventogenic genes, such as adh E1 (CAP0162), adh E2 (CAP0035 ), ctf A (CAP0163), ctf B (CAP0164), adc (CAP0165), bdh A (CAC3298), bdh B (CAC3299), etc., having expression profiles that show a strictly correlated pattern with the...”
- The role of PerR in O2-affected gene expression of Clostridium acetobutylicum
Hillmann, Journal of bacteriology 2009 - “...acetyl coenzyme A (CoA). The megaplasmid-carried sol operon (CAP0162 to CAP0164) was slightly upregulated upon exposure to O2 (Table 2). Its protein products...”
- “...Fold regulation ORF and functiona Energy conversion CAP0162 CAP0163 CAP0164 CAC0116 CAC0587 CAC0711 CAC0712 CAC0713 CAC2452 CAC2458 CAC2459 CAC2499 CAC2708...”
- Intracellular butyryl phosphate and acetyl phosphate concentrations in Clostridium acetobutylicum and their implications for solvent formation
Zhao, Applied and environmental microbiology 2005 - “...4A) were the solvent formation genes, including adhE1 (CAP0162), ctfA (CAP0163), ctfB (CAP0164), adc (CAP0165), bdhA (CAC3298), bdhB (CAC3299), and a second...”
- Transcriptional program of early sporulation and stationary-phase events in Clostridium acetobutylicum
Alsaker, Journal of bacteriology 2005 - “...solventogenesis. Solventogenic pSOL1 megaplasmid genes aad-ctfA-ctfB (CAP0162 to CAP0164) and adc (CAP0165) and chromosomal solventogenic genes bdhA (CAC3299)...”
- DNA array-based transcriptional analysis of asporogenous, nonsolventogenic Clostridium acetobutylicum strains SKO1 and M5
Tomas, Journal of bacteriology 2003 - “...culture. The major solvent formation genes aad (adhe1, CAP0162), cftA (CAP0163), ctfB (CAP0164), adc (CAP0165), and adh (CAP0059) are present, while adhe2...”
- Co‑cultivation of anaerobic fungi with Clostridium acetobutylicum bolsters butyrate and butanol production from cellulose and lignocellulose
Brown, Journal of industrial microbiology & biotechnology 2023 - “...condition is likely further along in solventogenesis compared to the monoculture. The alcohol dehydrogenase adhE1 (CA_P0162), which catalyzes butanol production, was also upregulated in the two-stage condition, further supporting that C. acetobutylicum was further into solventogenesis compared to monoculture. It is well-established that these pSOL1 megaplasmid...”
- A CRISPR/Anti-CRISPR Genome Editing Approach Underlines the Synergy of Butanol Dehydrogenases in Clostridium acetobutylicum DSM 792
Wasels, Applied and environmental microbiology 2020 (secret) - Improved n-Butanol Production from Clostridium cellulovorans by Integrated Metabolic and Evolutionary Engineering
Wen, Applied and environmental microbiology 2019 - “...genes. There are two homologous adhE genes: adhE1 (CA_p0162, located in the sol operon orfL-adhE1-ctfA-ctfB) and adhE2 (CA_p0035, a monocistronic operon) in the...”
- “...cellulovorans Derived from pXY1-Pthl, with the adhE1 (CA_p0162) gene from C. acetobutylicum overexpression Derived from pXY1-Pthl, with adhE2 (CA_p0035) gene...”
- Clostridium acetobutylicum grows vegetatively in a biofilm rich in heteropolysaccharides and cytoplasmic proteins
Liu, Biotechnology for biofuels 2018 - “...Acetyl coenzyme A acetyltransferase (thiolase) 26 CA_P0165 725 23,797 22 8 3.3 Acetoacetate decarboxylase 27 CA_P0162 3768 95,774 175 32 3.2 Alcohol dehydrogenase E 28 CA_C0711 452 26,698 17 11 3.1 Triosephosphate isomerase 29 CA_C2597 461 17,599 19 5 3.1 Hypothetical protein 30 CA_C3558 1128 48,599...”
- Genome and transcriptome of the natural isopropanol producer Clostridium beijerinckii DSM6423
Máté, BMC genomics 2018 - “...between C. beijerinckii and C. acetobutylicum strains. In C. acetobutylicum ATCC824, the corresponding genes adhE (CA_P0162), ctfA (CA_P0163) and ctfB (CA_P0164) are located on the mega-plasmid pSOL1 and only induced during solvantogenesis, while adc (CA_P0165) is organized in a monocistronic operon in the opposite direction [...”
- Protein Acetylation and Butyrylation Regulate the Phenotype and Metabolic Shifts of the Endospore-forming Clostridium acetobutylicum
Xu, Molecular & cellular proteomics : MCP 2018 - “...(promoter region of CA_C2071) and Psol (promoter region of CA_P0162- 0164) were amplified by PCR using the primers listed in supplemental Table S8. PCR products...”
- Elucidation of the roles of adhE1 and adhE2 in the primary metabolism of Clostridium acetobutylicum by combining in-frame gene deletion and a quantitative system-scale approach
Yoo, Biotechnology for biofuels 2016 (no snippet) - Quantitative proteomic analysis of the influence of lignin on biofuel production by Clostridium acetobutylicum ATCC 824
Raut, Biotechnology for biofuels 2016 - “...were down-regulated in lignin condition (CL), particularly, acetate kinase (CA_C1743), phosphate acetyltransferase (CA_C1742), acetaldehyde dehydrogenase (CA_P0162), butyrate kinase (CA_C3075) and phosphate transbutyrylase (CA_C3076) (Fig. 7 ). However, no significant difference was observed in acids production in both conditions, but Fig. 3 c, d indicates decreased acid...”
- More
B7017_1841 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Bifidobacterium breve JCM 7017
50% identity, 93% coverage
- Comparative genomics and genotype-phenotype associations in Bifidobacterium breve
Bottacini, Scientific reports 2018 - “...al . 22 B7017_1840 NRBB01_1659 Hypothetical membrane spanning protein PF14256 Bottacini et al . 22 B7017_1841 NRBB01_1660 Aldehyde-alcohol dehydrogenase PF00465 Bottacini et al . 22 B7017_1842/ NRBB01_1661 Transcriptional regulator, AraC family PF12833 Bottacini et al . 22 B7017_1843/ NRBB01_1662 Alcohol dehydrogenase X PF08240 Bottacini et al...”
NRBB01_1660 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Bifidobacterium breve
50% identity, 93% coverage
- Comparative genomics and genotype-phenotype associations in Bifidobacterium breve
Bottacini, Scientific reports 2018 - “.... 22 B7017_1840 NRBB01_1659 Hypothetical membrane spanning protein PF14256 Bottacini et al . 22 B7017_1841 NRBB01_1660 Aldehyde-alcohol dehydrogenase PF00465 Bottacini et al . 22 B7017_1842/ NRBB01_1661 Transcriptional regulator, AraC family PF12833 Bottacini et al . 22 B7017_1843/ NRBB01_1662 Alcohol dehydrogenase X PF08240 Bottacini et al ....”
CPRO_10650 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Anaerotignum propionicum DSM 1682
48% identity, 95% coverage
BCAL_RS04755 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Bifidobacterium callitrichos DSM 23973
50% identity, 93% coverage
CLNEO_13930 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Anaerotignum neopropionicum
49% identity, 95% coverage
cgd8_1720 acetaldehyde reductase plus alcohol dehydrogenase (AdhE) of possible bacterial origin from Cryptosporidium parvum Iowa II
47% identity, 97% coverage
- Lower micromolar activity of the antifungal imidazoles on the bacterial-type bifunctional aldehyde/alcohol dehydrogenase (AdhE) in Cryptosporidium parvum and in vitro efficacy against the zoonotic parasite
Chen, International journal for parasitology. Drugs and drug resistance 2024 - “...molecular mass at 89.8kDa. It is annotated as aldehyde/alcohol dehydrogenase at the CryptoDB (gene ID cgd8_1720; https://cryptodb.org/cryptodb/app/record/gene/cgd8_1720 ). CpAdhE contains two functional domains: an N-terminal aldehyde dehydrogenase domain (AldeDH; InterPro ID IPR015590) and a C-terminal alcohol dehydrogenase domain (ADH; IPR001670) ( Fig. 2 A). Sequence analysis...”
- Enrichment and proteomic identification of Cryptosporidium parvum oocyst wall
Wang, Parasites & vectors 2022 - “...53.788 270.63 No NA cgd6_1080 60kDa glycoprotein 28.64 270.35 Yes Sporozoites, parasitophorous vacuole membrane (PVM) cgd8_1720 Acetaldehyde reductase plus alcohol dehydrogenase (AdhE) of possible bacterial origin (fragment) 94.734 251.12 No NA cgd6_4460 Large protein with ARM repeats (fragment) 278.39 222.55 No NA cgd7_320 60S ribosomal protein...”
- Beg, Borrow and Steal: Three Aspects of Horizontal Gene Transfer in the Protozoan Parasite, Cryptosporidium parvum
Sateriale, PLoS pathogens 2016 - “...via lactate dehydrogenase (LDH, cgd7_480 ) or from acetyl-CoA via a bifunctional alcohol dehydrogenase (ADHE, cgd8_1720 ). B. Nucleotide salvage. Cryptosporidium relies on inosine 5 monophosphate dehydrogenase (IMPDH) to convert deoxyadenosine monophosphate (dAMP) to guanosine monophosphate (dGMP) within the parasitophorous vacuole. Dihydrofolate reductase-thymidylate synthase (DHFR-TS, cgd4_4460...”
- Determining the protein repertoire of Cryptosporidium parvum sporozoites
Sanderson, Proteomics 2008 - “...deactylase), cgd8_1700 (NAD dependent dehydrogenase), cgd8_1720 (acetaldehyde reductase plus alcohol dehydrogenase), cgd8_3290 (methyltransferase involved in...”
LLKF_2398 alcohol dehydrogenase/ acetaldehyde dehydrogenase from Lactococcus lactis subsp. lactis KF147
NCDO2118_2257 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Lactococcus lactis subsp. lactis NCDO 2118
46% identity, 93% coverage
llmg_2432 alcohol-acetaldehyde dehydrogenase from Lactococcus lactis subsp. cremoris MG1363
46% identity, 93% coverage
- Manganese Modulates Metabolic Activity and Redox Homeostasis in Translationally Blocked Lactococcus cremoris, Impacting Metabolic Persistence, Cell Culturability, and Flavor Formation
Nugroho, Microbiology spectrum 2022 - “...1.40 3.20 NADH oxidase (EC 1.6.-.-) noxC llmg_1770 6.760.14 6.190.11 0.27 2.77 Aldehyde-alcohol dehydrogenase adhE llmg_2432 8.10.05 7.720.13 0.41 2.53 Putative electron transport protein llmg_1916 6.90.1 6.580.04 0.48 2.64 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) pmsR msrA llmg_2281 6.250.06 5.970.07 0.52 2.71 Glycine...”
- Transcriptome landscape of Lactococcus lactis reveals many novel RNAs including a small regulatory RNA involved in carbon uptake and metabolism
van, RNA biology 2016 - “...1.64 3.48 25.8 3.80E-07 1.10E-04 3.1 13.17 llmg_2150 1.29 3.88 17.1 3.60E-05 5.10E-03 2.4 7.61 llmg_2432 1.22 6.38 18.4 1.80E-05 3.10E-03 2.3 8.33 llmg_0629 1.1 6.31 13.2 2.80E-04 2.90E-02 2.1 5.09 llmg_0294 1.14 8.29 13.3 2.60E-04 2.90E-02 2.2 5.11 llmg_0253 1.15 8.67 16.8 4.10E-05 5.50E-03 2.2...”
- Early adaptation to oxygen is key to the industrially important traits of Lactococcus lactis ssp. cremoris during milk fermentation
Cretenet, BMC genomics 2014 - “...COG number COG functional categories Gene name Gene product 1 h 5 h 8 h llmg_2432 COG1012 C adhE alcohol-acetaldehyde dehydrogenase 7.45 llmg_0100 COG2217 P cadA cation-transporting ATPase 4.06 llmg_1865 COG3104 E dtpT di-/tripeptide transporter 2.11 llmg_0758 COG0038 P eriC Putative chloride channel protein. 2.04 llmg_1551...”
- “...ATTACAGGAGCAGCTCGAAAAC 10.3 2.8 28.3 4.7 6.9 llmg_0776 trxB2 thioredoxin reductase TGGTCTtTATGCGGCTTTTTAt GGTAAAGATTTTGtGGcTGACC 4.3 13.3 2.4 llmg_2432 adhE alcohol-acetaldehyde dehydrogenase GGTTCTGAAGTGACTCCATTTG TCATAACAAACTCAGGGTCAACA 7.5 8.55 llmg_1464 adlC alpha-acetolactate decarboxylase GGCTGACCAACCTTATTTTACA TTCaGTgATGAAATTTTGGACA 4.6 3.7 11.8 2.3 4.8 llmg_1699 choS choline ABC transporter permease TTTTGCAAGTCACaGGAATTTTT GGaAAAATCGCATAAACAACAAG 3.6 10.0 4.1 3.1...”
- High yields of 2,3-butanediol and mannitol in Lactococcus lactis through engineering of NAD⁺ cofactor recycling
Gaspar, Applied and environmental microbiology 2011 - “...deletions. The ldhB (llmg_0392), ldhX (llmg_1429), and adhE (llmg_2432) genes were deleted in L. lactis strains by using a two-step homologous recombination...”
BQ1177_RS09345 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Ligilactobacillus salivarius
46% identity, 96% coverage
GL50803_93358 Bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Giardia intestinalis
45% identity, 96% coverage
- Characterization of the Giardia intestinalis secretome during interaction with human intestinal epithelial cells: The impact on host cells
Ma'ayeh, PLoS neglected tropical diseases 2017 - “...Rab11 GL50803_95593 Kinase, NEK GL50581_3318 Hypothetical protein GL50803_9413 PDI2Protein disulfide isomerase GL50581_3249 Ribosomal protein S21 GL50803_93358 Alcohol dehydrogenase GL50581_3195 VSP GL50803_91504 Hypothetical protein GL50581_2900 Protein 21.1 GL50803_9088 * 4-methyl-5-thiazole monophosphate biosynthesis enzyme GL50581_2665 Kinase, NEK GL50803_9030 Protein 21.1 GL50581_2356 Spindle pole protein, putative GL50803_8742 * Extracellular...”
- Reconstruction of Sugar Metabolic Pathways of Giardia lamblia
Han, International journal of proteomics 2012 - “...include the accession number used to identify the protein. We identified the aforementioned protein, as GL50803_93358 which scored high bit-scores (870) for both alcohol dehydrogenase and acetaldehyde dehydrogenase. The best-scored hit of this protein, tel:tlr0227, is also incidentally a bifunctional acetaldehyde-CoA and alcohol dehydrogenase from the...”
- “...GL50803_17063 1008 0.0 6.2.1.13 Acetyl-CoA synthetase (ADP-forming) GL50803_13608 507 5.00 10 146 1.1.1.1 Alcohol dehydrogenase GL50803_93358 870 0.0 eutG Ethanol:NAD + oxidoreductase GL50803_93358 717 0.0 1.2.1.10 Acetaldehyde dehydrogenase GL50803_93358 870 0.0...”
SMU_148, SMU_RS00740 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Streptococcus mutans UA159
Q8DWB9 Aldehyde-alcohol dehydrogenase from Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
46% identity, 94% coverage
- Mass spectrometry and split luciferase complementation assays reveal the MecA protein interactome of Streptococcus mutans
Qin, Microbiology spectrum 2024 - “...PflB SMU_RS05480 3.4 6-phosphofructokinase, PfkA SMU_RS03370 3.1 Triose-phosphate isomerase, TpiA SMU_RS07095 3 Glycogen/starch/alpha-glucan phosphorylase, GlgP SMU_RS00740 2.1 2.6 4 Bifunctional acetaldehyde-CoA/alcohol dehydrogenase, AdhE SMU_RS03175 2.3 3 Aconitate hydratase, AcnA SMU_RS05475 2.2 Pyruvate kinase, Pyk SMU_RS01780 2.2 Phosphoglycerate kinase, Pgk SMU_RS01775 2 Type I glyceraldehyde-3-phosphate dehydrogenase, Gap...”
- Genomic and phenotypic characterization of Streptococcus mutans isolates suggests key gene clusters in regulating its interaction with Streptococcus gordonii
Liu, Frontiers in microbiology 2022 - “...hypothetical protein 479 1,483 <0.001 SMU_270 PTS system ascorbate-specific transporter subunit IIC 417 680 <0.001 SMU_148 bifunctional acetaldehyde-CoA/alcohol dehydrogenase 3,287 8,200 <0.001 SMU_298 hypothetical protein 252 429 <0.001 SMU_503c hypothetical protein 74 207 <0.001 SMU_180 oxidoreductase 3,461 7,083 <0.001 SMU_609 40K cell wall protein 2,290 5,527...”
- Effects of Arginine on Streptococcus mutans Growth, Virulence Gene Expression, and Stress Tolerance
Chakraborty, Applied and environmental microbiology 2017 - “...competence (comYC), metabolism (SMU_132 and SMU_148), cell wall biosynthesis (SMU_609), transcriptional regulation (SMU_207c), molecular chaperones (hrcA,...”
- RNA-Seq Reveals Enhanced Sugar Metabolism in Streptococcus mutans Co-cultured with Candida albicans within Mixed-Species Biofilms
He, Frontiers in microbiology 2017 - “...four-enzyme pyruvate dehydrogenase complex [ pdhD (SMU_1424)- pdhA (SMU_1423) -pdhB (SMU_1422) -pdhC (SMU_1421)] and adhE (SMU_148) showed the highest up-regulation in mixed-species biofilms (fold change > 4.5, Figure 1B ). All of these five genes are part of the pyruvate metabolism pathway, converting pyruvate to acetyl-CoA...”
- S-glutathionylation proteome profiling reveals a crucial role of a thioredoxin-like protein in interspecies competition and cariogenecity of Streptococcus mutans
Li, PLoS pathogens 2020 - “...based on KEGG clustering. Protein accession KEGG term Gene name Modified cysteine site(s) Functional description Q8DWB9 Butanoate metabolism adhE 156, 317, 826, 868 Aldehyde-alcohol dehydrogenase Q59934 pfl 382 Formate acetyltransferase Q8CWY9 Nitrogen metabolism gltA 190, 285, 1012 Glutamate synthase (Large subunit) Q8CWY8 gltB 108, 112, 309,...”
MMAR_4110 aldehyde dehydrogenase from Mycobacterium marinum M
43% identity, 95% coverage
- DNA vaccination with the Mycobacterium marinum MMAR_4110 antigen inhibits reactivation of a latent mycobacterial infection in the adult Zebrafish
Niskanen, Vaccine 2020 (PubMed)- “...Mycobacterium marinum MMAR_4110 antigen inhibits reactivation of a latent mycobacterial infection in the adult Zebrafish Vaccine Journal fla 0264410X 38 35 5685...”
- “...genes, MMAR_0444, MMAR_0514, MMAR_0552, MMAR_0641, MMAR_1093, MMAR_4110 and MMAR_4524, were upregulated during reactivation when compared to both dormant...”
- Integrating fish models in tuberculosis vaccine development
Saralahti, Disease models & mechanisms 2020 - “...mycobacterial genes specifically expressed during reactivation. When seven of these were tested as vaccine antigens, MMAR_4110 was shown to be protective against the reactivation of M. marinum infection in zebrafish ( Niskanen et al., 2020 ). Although MMAR_4110, an aldehyde dehydrogenase, does not have a clear...”
- “..., Myllymki H. and Rmet M. ( 2020 ). DNA vaccination with the Mycobacterium marinum MMAR_4110 antigen inhibits reactivation of a latent mycobacterial infection in the adult zebrafish . Vaccine 38 , 5685 - 5694 . 10.1016/j.vaccine.2020.06.053 32624250 Oehlers S. H. , Cronan M. , Scott...”
Mvan_0443 iron-containing alcohol dehydrogenase from Mycobacterium vanbaalenii PYR-1
42% identity, 100% coverage
Q70YJ9 alcohol dehydrogenase (EC 1.1.1.1); acetaldehyde dehydrogenase (acetylating) (EC 1.2.1.10) from Polytomella sp. Pringsheim 198.80 (see paper)
44% identity, 95% coverage
3zdrA Structure of the alcohol dehydrogenase (adh) domain of a bifunctional adhe dehydrogenase from geobacillus thermoglucosidasius ncimb 11955 (see paper)
66% identity, 47% coverage
Ldb1707 Acetaldehyde dehydrogenase from Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
50% identity, 52% coverage
F9UTT1 Acetaldehyde dehydrogenase from Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
lp_0329 acetaldehyde dehydrogenase from Lactobacillus plantarum WCFS1
50% identity, 52% coverage
- Identification of key proteins and pathways in cadmium tolerance of Lactobacillus plantarum strains by proteomic analysis.
Zhai, Scientific reports 2017 - “...family, TMR-like 1.70 F9URB2 lp_2604; NAD(P)-dependent oxidoreductase 1.53 F9US17 nrdG; Anaerobic ribonucleoside-triphosphate reductase-activating protein 1.55 F9UTT1 acdH; Acetaldehyde dehydrogenase 1.55 F9UNI0 ribB; Riboflavin synthase, alpha chain 5.89 F9UR64 npr2; NADH peroxidase 4.38 F9ULD3 cat; Catalase 3.76 F9UN44 gshR2; glutathione reductase 4.67 F9UUC2 nox5; NADH oxidase 2.30...”
- Response of Lactobacillus plantarum WCFS1 to the Gram-Negative Pathogen-Associated Quorum Sensing Molecule N-3-Oxododecanoyl Homoserine Lactone
Spangler, Frontiers in microbiology 2019 - “...nagB or lp_0226, and ldhL2 or lp_1101), and 1 at 7 h ( acdH or lp_0329). The genes upregulated at 1 h and 4 h are involved in carbohydrate metabolism, while acdH encodes a putative acetaldehyde dehydrogenase. Furthermore, the ldhL gene observed as upregulated at multiple...”
- Transcriptomes reveal genetic signatures underlying physiological variations imposed by different fermentation conditions in Lactobacillus plantarum
Bron, PloS one 2012 - “...of oxygen, like alcohol dehydrogenase ( adhE; lp_3662 ) and acetaldehyde dehydrogenase ( acdH ; lp_0329 ), which may very well relate to their role in maintenance of the redox balance during anaerobic fermentation [44] . Detailed analysis of the upstream regions of the genes in...”
- Functional analysis of the role of CggR (central glycolytic gene regulator) in Lactobacillus plantarum by transcriptome analysis
Rud, Microbial biotechnology 2011 - “...rexB ATPdependent nuclease, subunit B 0.7 lp_3023 umuC UVdamage repair protein 1.5 1.6 Energy metabolism lp_0329 acdH Acetaldehyde dehydrogenase 3.3 a lp_0852 pox2 Pyruvate oxidase 2.3 lp_1112 fum Fumarate hydratase 0.8 lp_2151 pdhD Pyruvate dehydrogenase complex, E3 component 2.8 lp_2152 pdhC Pyruvate dehydrogenase complex, E2 component...”
- Identification of prebiotic fructooligosaccharide metabolism in Lactobacillus plantarum WCFS1 through microarrays
Saulnier, Applied and environmental microbiology 2007 - “...lp_0184 lp_0185 lp_0187 lp_0189 lp_0193 lp_0280 lp_0286 lp_0329 lp_0393 lp_0764 lp_0849 lp_1101 lp_1102 lp_1105 lp_1106 lp_1107 lp_1108 lp_1109 lp_1112 lp_1273...”
- “...M FOD1.5b Energy metabolism and transport lp_0230 lp_0329 lp_0349 lp_0436 lp_0576 lp_0575 lp_0577 lp_0587 lp_0822 lp_1083 lp_1386 lp_1409 lp_1466 lp_1468...”
Tph_c06970 acetaldehyde dehydrogenase (acetylating) from Thermacetogenium phaeum DSM 12270
49% identity, 54% coverage
- Alternative Pathways of Acetogenic Ethanol and Methanol Degradation in the Thermophilic Anaerobe Thermacetogenium phaeum
Keller, Frontiers in microbiology 2019 - “...1 ). Four alcohol dehydrogenases (Tph_c04230, Tph_c04260, Tph_c08270, and Tph_c18280) and one acetylating acetaldehyde dehydrogenase (Tph_c06970) are encoded in the genome. The acetylating acetaldehyde dehydrogenase is located in a gene cluster with other enzymes responsible for ethanolamine degradation and was induced in cells grown with ethanolamine...”
- “...In T. phaeum , the cluster contains genes encoding proteins annotated as acetylating acetaldehyde dehydrogenase (Tph_c06970) and aldehyde:ferredoxin oxidoreductase (Tph_c07090). The eut cluster also contains an eutP gene (Tph_c06900), which was described as encoding an acetate kinase ( Moore and Escalante-Semerena, 2016 ). This protein was...”
CLJU_RS05830 1-propanol dehydrogenase PduQ from Clostridium ljungdahlii DSM 13528
54% identity, 47% coverage
Pcar_2758 NAD-dependent aldehyde dehydrogenases from Pelobacter carbinolicus str. DSM 2380
48% identity, 51% coverage
- Degradation of acetaldehyde and its precursors by Pelobacter carbinolicus and P. acetylenicus
Schmidt, PloS one 2014 - “...dehydrogenase gene cluster (Pcar_0833-0835) detectable which was less abundant. Furthermore, an additional acetylating acetaldehyde dehydogenase (Pcar_2758) was expressed in tungstate-rich medium. 10.1371/journal.pone.0115902.g002 Figure 2 Two-dimensional PAGE comparison of soluble proteins of P. carbinolicus grown on 20 mM ethanol in tungstate-free or tungstate-rich medium to identify differentially...”
- “...assimilation. Two acetylating acetaldehyde dehydrogenase gene loci could be identified: Pcar_1246 is constitutively expressed and Pcar_2758 was found additionally in fast-growing, tungstate-supplied cultures. Expression and activity of these acetylating acetaldehyde dehydrogenases is in agreement with the detected activities of the subsequent substrate-level phosphorylation enzymes phosphotransacetylase and...”
- The genome of Pelobacter carbinolicus reveals surprising metabolic capabilities and physiological features
Aklujkar, BMC genomics 2012 - “...3-hydroxypropanoyl-CoA is an intermediate. P . carbinolicus possesses multiple predicted isozymes of acetaldehyde dehydrogenase (Pcar_1246, Pcar_2758, Pcar_2851), phosphate acetyltransferase (Pcar_2542 and Pcar_2850) and acetate kinase (Pcar_2543 and Pcar_0557) that could nonspecifically catalyze these reactions. The final ATP-yielding step might also be catalyzed by propanoate kinase (Pcar_2427)...”
- “...3.4-fold compared to 2,3-butanediol oxidation (our unpublished microarray data), suggesting that its function is oxidative; Pcar_2758 is upregulated during ethanol oxidation 7.2-fold compared to acetoin fermentation [ 9 ] and 4.2-fold compared to 2,3-butanediol fermentation, but downregulated during 2,3-butanediol oxidation 4.6-fold compared to 2,3-butanediol fermentation (our...”
- Constraint-based modeling analysis of the metabolism of two Pelobacter species
Sun, BMC systems biology 2010 - “...levels during ethanol/Fe(III) respiration include Pcar_0251 and Pcar_0255 for the alcohol dehydrogenase (ethanol:NAD) reaction and Pcar_2758 for the acetaldehyde dehydrogenase reaction, involved in the oxidation of ethanol to acetyl-CoA[ 17 ]. These genes were downregulated more than 5 fold during acetoin fermentation compared to ethanol/Fe(III) respiration...”
- Genome-wide gene expression patterns and growth requirements suggest that Pelobacter carbinolicus reduces Fe(III) indirectly via sulfide production
Haveman, Applied and environmental microbiology 2008 - “...other as an NADdependent aldehyde dehydrogenase (aldH; Pcar_2758). Based on homology with characterized proteins, AorA is expected to produce acetate directly...”
Pcar_2851 aldehyde-alcohol dehydrogenase from Pelobacter carbinolicus str. DSM 2380
52% identity, 51% coverage
- The genome of Pelobacter carbinolicus reveals surprising metabolic capabilities and physiological features
Aklujkar, BMC genomics 2012 - “...is an intermediate. P . carbinolicus possesses multiple predicted isozymes of acetaldehyde dehydrogenase (Pcar_1246, Pcar_2758, Pcar_2851), phosphate acetyltransferase (Pcar_2542 and Pcar_2850) and acetate kinase (Pcar_2543 and Pcar_0557) that could nonspecifically catalyze these reactions. The final ATP-yielding step might also be catalyzed by propanoate kinase (Pcar_2427) or...”
- “...fermentation (our unpublished microarray data), indicating both oxidative and reductive roles; and the third isozyme, Pcar_2851, is not differentially expressed. Four genes encode putative acetaldehyde:ferredoxin oxidoreductases ( aorA 1 Pcar_0254, aorA 2 Pcar_0456, aorA 3 Pcar_0665, and aorA 4 Pcar_2853) sharing 72-79% sequence identity. Transcription of...”
OG1RF_11340 acetaldehyde dehydrogenase (acetylating) from Enterococcus faecalis OG1RF
49% identity, 50% coverage
- Comparative Biofilm Assays Using Enterococcus faecalis OG1RF Identify New Determinants of Biofilm Formation
Willett, mBio 2021 - “...protein 3.19 6.76E108 2.22 1.44E122 OG1RF_10533 560068 Cell wall lysis protein 2.56 3.41E279 1.66 1.52E112 OG1RF_11340 1403263 Acetaldehyde dehydrogenase 2.96 1.87E74 1.79 2.17E42 OG1RF_11710 1790332 O-antigen polymerase 2.12 2.90E4 2.36 1.28E14 OG1RF_11715 1794475 Glycosyltransferase 3.93 9.82E4 4.84 1.87E06 a NA, not applicable. For SmarT TnSeq library...”
- “...family beta-glucosides porter, IIABC component 7.96E03 1.42 1 1383159 OG1RF_11322 Beta-glucosidase 4.06E02 1.39 1 1403263 OG1RF_11340 Acetaldehyde dehydrogenase 1.87E74 2.96 1 2.17E42 1.79 1 1407029 OG1RF_11344 Ethanolamine ammonia-lyase large subunit 1.73E05 1.45 1 1420208 OG1RF_11357 GTP-sensing transcriptional pleiotropic repressor CodY 8.20E17 2.28 1 1458455 Intergenic_1452 7.92E33...”
5j7iB Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
50% identity, 52% coverage
- Ligand: adenosine-5-diphosphoribose (5j7iB)
Q8Y7U1 Lmo1179 protein from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
lmo1179 similar to acetaldehyde dehydrogenase / alcohol dehydrogenase from Listeria monocytogenes EGD-e
47% identity, 52% coverage
- Enzyme engineering and in vivo testing of a formate reduction pathway
Wang, Synthetic biology (Oxford, England) 2021 - “...obtained from UniProt via a pHMMER search ( E -value<710 17 ) with query LmACDH (Q8Y7U1) or enzyme commission number search (EC 1.2.1.10), or from BRENDA (EC 1.2.1.10). After alignment and clustering of ACDHs, mhpF-like sequences were removed, leaving 4037 adhE-like sequences from which the final...”
- Bacterial Microcompartments Coupled with Extracellular Electron Transfer Drive the Anaerobic Utilization of Ethanolamine in Listeria monocytogenes
Zeng, mSystems 2021 - “...dra (deoxyribose-phosphate aldolase), is predicted to have an interaction with the acetaldehyde dehydrogenase eutE ( lmo1179 ) (according to STRING analysis) ( Fig.3C ; TableS4 ). Another group of overlapping genes comprises potential ABC transporters, including lmo2751-lmo2752 (ABC transporter ATP-binding protein) ( 34 ), and ilvC...”
- Sublethal Concentrations of Antibiotics Cause Shift to Anaerobic Metabolism in Listeria monocytogenes and Induce Phenotypes Linked to Antibiotic Tolerance
Knudsen, Frontiers in microbiology 2016 - “...acetaldehyde-CoA/alcohol dehydrogenase encoded by lmo1634 did not have altered antibiotic tolerance. However, a mutant in lmo1179 ( eutE ) encoding an aldehyde oxidoreductase where rerouting caused increased ethanol production was tolerant to three of four antibiotics tested. This shift in metabolism could be a survival strategy...”
- “...L. monocytogenes virulent wild-type, MLST ST35 W. Goebel lmo1634 Inframe deletion of lmo1634 This study lmo1179 Inframe deletion of lmo1179 This study lmo1634/ lmo1179 Inframe deletion of lmo1634 and lmo1179 This study lmaDCBA Inframe deletion of lmaDCBA This study Plasmids pAUL-A Temperature sensitive origin of replication,...”
- A postgenomic appraisal of osmotolerance in Listeria monocytogenes
Sleator, Applied and environmental microbiology 2003 - “...sequence similarities to gbsA (lmo0913, lmo0383, and lmo1179) and gbsB (pduQ, lmo1634, lmo1166, and lmo0554), encoding a glycine betaine aldehyde dehydrogenase...”
EF1624 aldehyde dehydrogenase, putative from Enterococcus faecalis V583
48% identity, 50% coverage
CD630_19070 1-propanol dehydrogenase PduQ from Clostridioides difficile 630
CD1907 putative ethanolamine/propanediol utilization propanol dehydrogenase from Clostridium difficile 630
51% identity, 47% coverage
- What's a SNP between friends: The influence of single nucleotide polymorphisms on virulence and phenotypes of Clostridium difficile strain 630 and derivatives
Collery, Virulence 2017 - “...region 309208 INV 129 41 IG Intergenic region 3528736 G T 94 100 630 erm CD630_19070 eutG 2209236 G A 127 97 Gly252Glu CD630_35650 GntR family transcriptional regulator 4166495 G A 182 100 Ala91Val IG Intergenic region 2937176 C A 173 100 IG Intergenic region 3005866...”
- “...the following genes: CD630_08260, encoding a ferric uptake regulator ( perR homolog) (Thr 41 Ala); CD630_19070, encoding an alcohol dehydrogenase homolog ( eutG ) (Gly 252 Glu); and CD630_35630, encoding a transcriptional regulator of the GntR family (Ala 91 Val). In contrast, strain 630E contains a...”
- Complete genome sequence of the Clostridium difficile laboratory strain 630Δerm reveals differences from strain 630, including translocation of the mobile element CTn5
van, BMC genomics 2015 - “...2137467_2183040del CD630_18440 Putative adhesin Translocation of CTn 5 , CD1844 restored 2209236 2168961 substitution G>A CD630_19070 eutG Ethanolamine iron-dependent Alcohol dehydrogenase Gly>Glu 2924655 2881973 substitution C>T CD630_25320 Aminotransferase, alanine--glyoxylate transaminase Synonymous 3034953 2992271 substitution C>A CD630_26270 Conserved hypothetical protein Gly>Cys 3080703 3038021 substitution C>T CD630_26670 ptsG-BC...”
- Ethanolamine is a valuable nutrient source that impacts Clostridium difficile pathogenesis
Nawrocki, Environmental microbiology 2018 - “...oMC548 5-GCTGTAATGCTTCAGTGGTAGA-3 tcdA PCR (CD0663) ( Edwards et al., 2014 ) oMC655 5-GAAATAGTACCAGACCCACCAATA-3 eutG PCR (CD1907) This study oMC656 5-TATTGCAGAACCACCACCTAAT-3 eutG PCR (CD1907) This study oMC657 5-CTAAAGAAGATATACATACAGGAGCAGT-3 eutA PCR (CD1912) This study oMC658 5-TAAATCAGGTCCTGCTGTTGC-3 eutA PCR (CD1912) This study oMC659 5-ATCAGGAGATAAATTAGCAGGTCTT-3 eutB PCR (CD1913) This study...”
- “...This study oMC667 5-CGCAAGTTTCTAATTTCGGTTCTTCCTCGATAGAGGAAAGTGTCT-3 eutA intron retargeting (CD1912) This study oMC674 5-AAAAGCTTTTGCAACCCACGTCGATCGTGAATCTACCTCGTTAGTGCGCCCAGATAGGGTG-3 eutG intron retargeting (CD1907) This study oMC675 5-CAGATTGTACAAATGTGGTGATAACAGATAAGTCTCGTTAATTAACTTACCTTTCTTTGT-3 eutG intron retargeting (CD1907) This study oMC676 5-CGCAAGTTTCTAATTTCGGTTGTAGATCGATAGAGGAAAGTGTCT-3 eutG intron retargeting (CD1907) This study oMC714 5-GGAGAAGGCTCACTAAAAGC-3 eutG verification This study oMC715 5-GCCTCTTTGCTTGTTTAAGAC-3 eutA verification This study...”
- Complete genome sequence of the Clostridium difficile laboratory strain 630Δerm reveals differences from strain 630, including translocation of the mobile element CTn5
van, BMC genomics 2015 - “...the putative acyl-CoA N-acyltransferase CD1190, predicted glyceraldehyde-phosphate dehydrogenase CD1767 ( gapB ), ethanolamine utilization protein CD1907 ( eutG ), the hypothetical protein CD2627, the phosphotransferase system protein CD2667 ( ptsG-BC ) and the transcriptional regulator CD3565. In all these cases, the de novo assembly of the...”
- Adaptive strategies and pathogenesis of Clostridium difficile from in vivo transcriptomics
Janoir, Infection and immunity 2013 - “...of carbon and/or nitrogen (19). The eut operon (CD1907 to CD1925), involved in ethanolamine utilization, is induced mainly late during the infection process and...”
- “...such as EutG (ethanolamine iron-dependent alcohol dehydrogenase; CD1907), a putative ferredoxin oxido-reductase (CD0115), and a rubrerythrin (CD2848), all of...”
- Structural insight into the Clostridium difficile ethanolamine utilisation microcompartment
Pitts, PloS one 2012 - “...10.1371/journal.pone.0048360.t001 Table 1 C. difficile eut operon organisation. Locus tag Start Stop Protein homologue Comment CD1907 2208482 2209612 EutG Alcohol dehydrogenase CD1908 2209853 2210203 EutS BMC protein CD1909 2210211 2210645 EutP GTPase CD1910 2210754 2211329 EutV Response regulator CD1911 2211322 2212731 EutW Sensor histidine kinase CD1912...”
Pcar_1246 NAD-dependent aldehyde dehydrogenase from Pelobacter carbinolicus str. DSM 2380
50% identity, 52% coverage
- Degradation of acetaldehyde and its precursors by Pelobacter carbinolicus and P. acetylenicus
Schmidt, PloS one 2014 - “...constitutively expressed proteins such as alcohol dehydrogenases (Pcar_0251 and Pcar 0255), an acetylating acetaldehyde dehydrogenase (Pcar_1246), a glutamine synthetase (Pcar_1501, likely responsible for ammonia uptake) and two subunits of a putative hydrogenase (Pcar_1633 and Pcar_1634). To link activity and protein identification, we applied our recently described...”
- “...of ATP synthesis and carbon assimilation. Two acetylating acetaldehyde dehydrogenase gene loci could be identified: Pcar_1246 is constitutively expressed and Pcar_2758 was found additionally in fast-growing, tungstate-supplied cultures. Expression and activity of these acetylating acetaldehyde dehydrogenases is in agreement with the detected activities of the subsequent...”
- The genome of Pelobacter carbinolicus reveals surprising metabolic capabilities and physiological features
Aklujkar, BMC genomics 2012 - “...if 3-hydroxypropanoyl-CoA is an intermediate. P . carbinolicus possesses multiple predicted isozymes of acetaldehyde dehydrogenase (Pcar_1246, Pcar_2758, Pcar_2851), phosphate acetyltransferase (Pcar_2542 and Pcar_2850) and acetate kinase (Pcar_2543 and Pcar_0557) that could nonspecifically catalyze these reactions. The final ATP-yielding step might also be catalyzed by propanoate kinase...”
- “...functions oxidatively as acetaldehyde dehydrogenase. Of the three predicted acetyl-CoA reductase isozymes (49-57% sequence identity), Pcar_1246 is downregulated during 2,3-butanediol fermentation 4.5-fold compared to ethanol oxidation and 3.4-fold compared to 2,3-butanediol oxidation (our unpublished microarray data), suggesting that its function is oxidative; Pcar_2758 is upregulated during...”
Dhaf_0356 acetaldehyde dehydrogenase (acetylating) from Desulfitobacterium hafniense DCB-2
46% identity, 52% coverage
SSA_0523 Aldehyde dehydrogenase, putative from Streptococcus sanguinis SK36
47% identity, 51% coverage
PMI2719 aldehyde-alcohol dehydrogenase from Proteus mirabilis HI4320
47% identity, 50% coverage
HMPREF0397_RS01520 acetaldehyde dehydrogenase (acetylating) from Fusobacterium nucleatum subsp. nucleatum ATCC 23726
47% identity, 52% coverage
EMQU_2205 acetaldehyde dehydrogenase (acetylating) from Enterococcus mundtii QU 25
47% identity, 51% coverage
- Complete genome sequence of Enterococcus mundtii QU 25, an efficient L-(+)-lactic acid-producing bacterium
Shiwa, DNA research : an international journal for rapid publication of reports on genes and genomes 2014 - “...genes involved in the PK pathway, PK (EMQU_1837), acetate kinase (EMQU_2620), phosphotransacetylase (EMQU_2119), acetaldehyde dehydrogenase (EMQU_2205), and alcohol dehydrogenase (EMQU_1129, EMQU_1829, and EMQU_2109) were dispersed throughout the chromosome. To get insights into the lactic acid fermentation characteristics of strain QU 25, we performed the comparative analysis...”
lmo1171 similar to NADPH-dependent butanol dehydrogenase from Listeria monocytogenes EGD-e
Q8Y7U8 PduQ protein from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
50% identity, 47% coverage
- Anaerobic Growth of Listeria monocytogenes on Rhamnose Is Stimulated by Vitamin B12 and Bacterial Microcompartment-Dependent 1,2-Propanediol Utilization
Zeng, mSphere 2021 - “...) suggests four putative candidates annotated as alcohol dehydrogenase in L. monocytogenes EGDe, including lmo1166, lmo1171, lmo1634, and lmo1737, detected in the proteomes of both pdu -noninduced and pdu -induced cells (for details see Text S1 in the supplemental material). Since the discovery of the role...”
- Sublethal Concentrations of Antibiotics Cause Shift to Anaerobic Metabolism in Listeria monocytogenes and Induce Phenotypes Linked to Antibiotic Tolerance
Knudsen, Frontiers in microbiology 2016 - “...encode an aldehyde oxidoreductase. The ADH domain of lmo1634 has three homologies ( eutG or lmo1171, lmo1166 , and lmo1165 ) with E-values between 4e -44 and 2e -88 (between 3141% identity with 4546% coverage). These four genes ( lmo1165, lmo1166, lmo1171 , and lmo1179 )...”
- “...the degradation pathway of ethanolamine to ethanol and acetyl-CoA. Neither of the four genes lmo1179, lmo1171, lmo1165 , or lmo1166 (gray) are differentially expressed by any of the four antibiotics. We suggest that L. monocytogenes EGD shift to anaerobic condition and production of ethanol to avoid...”
- The transcriptional response of Listeria monocytogenes during adaptation to growth on lactate and diacetate includes synergistic changes that increase fermentative acetoin production
Stasiewicz, Applied and environmental microbiology 2011 - “...metabolism gene (lmo0192 purR), energy metabolism gene (lmo1171 adhE) Hemolysin genes (lmo0202 hly, lmo2738), pyruvate dehydrogenase repressor gene (lmo0948),...”
- Proteomic Analysis of Listeria monocytogenes FBUNT During Biofilm Formation at 10°C in Response to Lactocin AL705
Melian, Frontiers in microbiology 2021 - “...protein lmo2215 Q8Y561 Energy production and conversion L-lactate dehydrogenase lmo1057 Q8Y860 NADPH-dependent butanol dehydrogenase lmo1171/pduQ Q8Y7U8 Formate dehydrogenase subunit alpha lmo2586 Q8Y469 Lipid metabolism Cardiolipin synthase lmo0008 Q8YAV5 D-alanine-poly(phosphoribitol) ligase subunit 1 lmo0974/dltA Q8Y8D4 Post-translational modification, protein turnover, and chaperones Protease HtpX homolog lmo0963/htpX Q8Y8E1 Replication,...”
CPF_0895 ethanolamine utilization protein from Clostridium perfringens ATCC 13124
46% identity, 50% coverage
- Molecular identification of hyaluronate lyase, not hyaluronidase, as an intrinsic hyaluronan-degrading enzyme in Clostridium perfringens strain ATCC 13124
Kumon, Scientific reports 2024 - “...CPF_0892 for ethanolamine ammonia-lyase small subunit, eutL (CPF_0893) for ethanolamine utilization, CPF_0894 for ethanolamine utilization, CPF_0895 for ethanolamine utilization, eutM (CPF_0896) for ethanolamine utilization, CPF_0897 for ethanolamine utilization cobalamin adenosyltransferase, CPF_0898 for ethanolamine utilization, CPF_0899 for ethanolamine utilization protein, eutN (CPF_0900) for ethanolamine utilization, CPF_0901 for...”
LM6179_1478 1-propanol dehydrogenase PduQ from Listeria monocytogenes 6179
50% identity, 47% coverage
Cphy_2642 acetaldehyde dehydrogenase (acetylating) from Clostridium phytofermentans ISDg
47% identity, 51% coverage
CD1917 putative ethanolamine/propanediol utilisation aldehyde-alcohol dehydrogenase from Clostridium difficile 630
CD630_19170 acetaldehyde dehydrogenase (acetylating) from Clostridioides difficile 630
47% identity, 51% coverage
- Clostridioides difficile exploits toxin-mediated inflammation to alter the host nutritional landscape and exclude competitors from the gut microbiota
Fletcher, Nature communications 2021 - “...expressed (log2 fold change 1 and adjusted p -value<0.05) between the strains in vitro ( CD1917 , encoding EutE, and CD3087 , encoding a transcription factor of the RpiR family) (Supplementary Data 1 ). When comparing in vivo expression profiles between the two strains, the majority...”
- Ethanolamine is a valuable nutrient source that impacts Clostridium difficile pathogenesis
Nawrocki, Environmental microbiology 2018 - “...PCR (CD1916) This study oMC864 5-TGTTCTTAATGTACCAACTCTGGA-3 eutM PCR (CD1916) This study oMC865 5-TGGTGAAGATAAGGAAGCCAATA-3 eutE PCR (CD1917) This study oMC866 5-GATGTTGGGTTTGTTGAAGGTATAA-3 eutE PCR (CD1917) This study oMC867 5-GCAGCAGATGCAATGGTTAAA-3 eutK PCR (CD1918) This study oMC868 5-CAGCTCCAACATCTCCTCTTAC-3 eutK PCR (CD1918) This study oMC869 5-TTTGGCGCTAAATTGGATGAAA-3 eutT PCR (CD1919) This study...”
- Structural insight into the Clostridium difficile ethanolamine utilisation microcompartment
Pitts, PloS one 2012 - “...Ethanolamine ammonia lyase CD1915 2216644 2217297 EutL BMC protein CD1916 2217308 2218009 EutK BMC protein CD1917 2218012 2219481 EutE Aldehyde dehydrogenase CD1918 2219567 2219854 EutM BMC protein CD1919 2219981 2220742 EutT Cobalamin adenosyltransferase CD1920 2220755 2221384 EutD Phosphotransacetylase CD1921 2221426 2222151 Unknown function CD1922 2222164 2222436...”
- Insight into Coenzyme A cofactor binding and the mechanism of acyl-transfer in an acylating aldehyde dehydrogenase from Clostridium phytofermentans
Tuck, Scientific reports 2016 - “...three Clostridium phytofermentans BMC loci (Cphy1178, Cphy1428, Cphy2642) and the Clostridium difficile ethanolamine utilisation locus (CD630_19170). The full-length recombinant enzymes produced for this study were unstable in various common buffer systems and aggregated rapidly upon purification; therefore, we produced truncations to remove the proposed BMC localisation...”
FN0084 Acetaldehyde dehydrogenase [acetylating] from Fusobacterium nucleatum subsp. nucleatum ATCC 25586
47% identity, 53% coverage
adh1 / P13604 NADPH-dependent butanol dehydrogenase (EC 1.1.1.2) from Clostridium saccharobutylicum (see 3 papers)
adh1 / GB|AAA83520.1 NADPH-dependent butanol dehydrogenase; EC 1.1.1.1 from Clostridium saccharobutylicum (see paper)
50% identity, 47% coverage
Clocel_3817 iron-containing alcohol dehydrogenase from Clostridium cellulovorans 743B
50% identity, 47% coverage
- Bioconversion of Lignocellulosic Biomass into Value Added Products under Anaerobic Conditions: Insight into Proteomic Studies
Vélez-Mercado, International journal of molecular sciences 2021 - “...phosphoenolpyruvate (PEP) to oxaloacetate. In addition, few alcohol dehydrogenases were upregulated in avicel, of which Clocel_3817 (an iron-containing alcohol dehydrogenase), was the most highly produced. The authors concluded that Clocel_3817 was possibly involved in the reduction of acetyl-coA to acetaldehyde initially, and later to ethanol, concomitantly...”
- “...phosphate dikinase (Clocel_1454 ** , Clocel_4349 ** ) Phosphoenolpyruvate carboxylase (Clocel_1149 ** ) Alcohol dehydrogenase (Clocel_3817 *** ) Downregulated Downregulated NIA Glyceraldehyde-3-phosphate dehydrogenase (Clocel_0719 * ) Malic enzyme (Clocel_0393 ** ) Glucose Upregulated Upregulated Upregulated [ 22 ] Glyceraldehyde-3-phosphate dehydrogenase (Clocel_0719 * ) Phosphoenolpyruvate carboxylase (Clocel_1149...”
- Improved n-Butanol Production from Clostridium cellulovorans by Integrated Metabolic and Evolutionary Engineering
Wen, Applied and environmental microbiology 2019 - “...dehydrogenase-encoding genes (Clocel_1140, Clocel_1949, Clocel_4197, Clocel_2402, and Clocel_3817), it is likely that one of them might be induced by the...”
PMI2717 propanediol utilization protein (alcohol dehydrogenase) from Proteus mirabilis HI4320
50% identity, 47% coverage
- Anaerobic choline metabolism in microcompartments promotes growth and swarming of Proteus mirabilis
Jameson, Environmental microbiology 2016 - “...Microcompartment/carboxysome/ethanolamine utilization protein (EutN_CcmL, PF03319.8) PMI2711 emrE homologue 8.6639517 7.24E13 Quaternary ammonium compound resistance protein PMI2717 cutO 9.6507023 1.08E10 Alcohol dehydrogenase PMI2710 emrE homologue 9.2090116 2.81E06 Multidrug resistance protein, EmrE homologue PMI0695 trxB 1.9182025 0.000123 Thioredoxin reductase PMI2713 cutH 5.5647202 0.000259 Phosphate acetyltransferase PMI0501 1.8393886 0.000698...”
Cspa_c04380 NADPH-dependent butanol dehydrogenase from Clostridium saccharoperbutylacetonicum N1-4(HMT)
50% identity, 47% coverage
CAETHG_3954 iron-containing alcohol dehydrogenase from Clostridium autoethanogenum DSM 10061
52% identity, 45% coverage
- Industrial Acetogenic Biocatalysts: A Comparative Metabolic and Genomic Analysis
Bengelsdorf, Frontiers in microbiology 2016 - “...growth conditions a specific alcohol dehydrogenase (CAETHG_1841) and during heterotrophic growth, a different alcohol dehydrogenase (CAETHG_3954) was significantly up-regulated. Any suggestions with respect to functions of those alcohol dehydrogenases were not provided ( Marcellin et al., 2016 ). For C. ragsdalei , it was demonstrated that...”
L21SP2_0358 iron-containing alcohol dehydrogenase from Salinispira pacifica
53% identity, 39% coverage
Ccar_04610 iron-containing alcohol dehydrogenase from Clostridium carboxidivorans P7
52% identity, 45% coverage
- Combination of Trace Metal to Improve Solventogenesis of Clostridium carboxidivorans P7 in Syngas Fermentation
Han, Frontiers in microbiology 2020 - “...Ccar_07995 adh Acetaldehyde dehydrogenase Alcohol synthesis from acetyl-CoA and butyral-CoA Ccar_00050 bdh50 NAD(P)H-dependent butanol dehydrogenase Ccar_04610 bdh10 NADPH-dependent butanol dehydrogenase Ccar_24835 bdh35 NADPH-dependent butanol dehydrogenase Ccar_25840 bdh40 NADPH-dependent butanol dehydrogenase Ccar_01440 CoAT CoA transferase Acid re-assimilation Results Effect of the Absence of Nickel, Iron, Cobalt, Selenium,...”
CAETHG_1841, CLAU_1794, CLJU_c39950 iron-containing alcohol dehydrogenase from Clostridium autoethanogenum DSM 10061
51% identity, 45% coverage
- Clostridium autoethanogenum alters cofactor synthesis, redox metabolism, and lysine-acetylation in response to elevated H2:CO feedstock ratios for enhancing carbon capture efficiency
Davin, Biotechnology for biofuels and bioproducts 2024 - “...CAETHG_3358 phosphate acetyltransferase 0.004* 0.49 CAETHG_3359 Acetate kinase 0.934 0.01 CAETHG_0555 Alcohol dehydrogenase 0.983 0.01 CAETHG_1841 Alcohol dehydrogenase 0.062 0.41 CAETHG_3029 Pyruvate ferredoxin/flavodoxin oxidoreductase 0.031 0.44 CAETHG_0124 Acetolactate synthase 0.900 0.02 CAETHG_0125 Acetolactate synthase small subunit 0.087 0.26 CAETHG_0406 Acetolactate synthase 0.006 0.30 CAETHG_1740 Acetolactate synthase...”
- Base editing enables duplex point mutagenesis in Clostridium autoethanogenum at the price of numerous off-target mutations
Seys, Frontiers in bioengineering and biotechnology 2023 - “...(A242V) Proof of concept of multiplex Target-AID vFS50 cFS05 C. autoethanogenum CLAU_532 (Q243X), CLAU_534 (A242V), CLAU_1794 (S251L, W278X) Proof of concept of multiplex Target-AID-NG vFS50, vFS74 cFS15 C. autoethanogenum CLAU_532 (Q243X), CLAU_534 (A242X) Proof of concept of multiplex Target-AID vFS50 2.2 Cloning and assembly In silico...”
- “.... 2.7 Determination of non-essentiality Prior to plasmid design the three genes CLAU_532, CLAU_534 and CLAU_1794 were cross-checked in the published list of essential genes determined by transposon insertion sequencing ( Woods et al., 2022 ) and confirmed to be non-essential under heterotrophic or autotrophic conditions....”
- Agr Quorum Sensing influences the Wood-Ljungdahl pathway in Clostridium autoethanogenum
Piatek, Scientific reports 2022 - “...for the agrD1D2 mutant. Bifunctional acetaldehyde-CoA/alcohol dehydrogenases AdhE1 and AdhE2 (CLAU_3655 and 3656), alcohol dehydrogenase (CLAU_1794) and aldehyde ferredoxin oxidoreductases (AOR) (CLAU_0099 and 0089) all were found in low abundance. The latter three enzymes are noted to play a role during autotrophic metabolism 31 , 34...”
- Control of solvent production by sigma-54 factor and the transcriptional activator AdhR in Clostridium beijerinckii
Yang, Microbial biotechnology 2020 - “...CAETHG_0386 is involved in 2,3butanediol synthesis (Kopke et al. , 2011 ), and CLJU_c24880 and CLJU_c39950 are involved in butanol degradation (Tan et al. , 2014 ). Thus, SigL may play a role in regulation of alcohol metabolism in various Clostridium species. Experimental procedures Strains and...”
- “...elements upstream of CLSA_RS07875 gene from C.saccharobutylicum , Cspa_c27830 gene from C.saccharoperbutylacetonicum , CLJU_c24880 and CLJU_c39950 genes from C.ljungdahlii and CAETHG_0385 gene from C.autoethanogenum were chemically synthesized by GenScript. The DNA fragment containing the three UAS sites in the promoter region of adhA1 or adhA2 genes...”
- Industrial Acetogenic Biocatalysts: A Comparative Metabolic and Genomic Analysis
Bengelsdorf, Frontiers in microbiology 2016 - “...of C. autoethanogenum by a systematic approach. Under autotrophic growth conditions a specific alcohol dehydrogenase (CAETHG_1841) and during heterotrophic growth, a different alcohol dehydrogenase (CAETHG_3954) was significantly up-regulated. Any suggestions with respect to functions of those alcohol dehydrogenases were not provided ( Marcellin et al., 2016...”
- Energy Conservation Associated with Ethanol Formation from H2 and CO2 in Clostridium autoethanogenum Involving Electron Bifurcation
Mock, Journal of bacteriology 2015 - “...(homologue of CAETHG_0555) and CLJU_c39950 (homologue of CAETHG_1841) (68). All three alcohol dehydrogenases have been shown to have activity with...”
- “...encoded by CLJU_c24880 (homologue of CAETHG_0555) and CLJU_c39950 (homologue of CAETHG_1841) (68). All three alcohol dehydrogenases have been shown to have...”
- Characterization of two novel butanol dehydrogenases involved in butanol degradation in syngas-utilizing bacterium Clostridium ljungdahlii DSM 13528
Tan, Journal of basic microbiology 2014 (PubMed)- “...13528. In this study two genes, CLJU_c24880 and CLJU_c39950, encoding putative butanol dehydrogenase (designated as BDH1 and BDH2) were identified in the genome...”
- “...putative genes encoding butanol dehydrogenases (CLJU_c24880, CLJU_c39950 and CLJU_c23460) were identified. The mRNA abundances for CLJU_c24880 and CLJU_c39950...”
Awo_c00730 iron-containing alcohol dehydrogenase from Acetobacterium woodii DSM 1030
50% identity, 47% coverage
Ccar_24835 iron-containing alcohol dehydrogenase from Clostridium carboxidivorans P7
49% identity, 47% coverage
CAETHG_0555, CLJU_c24880 iron-containing alcohol dehydrogenase from Clostridium autoethanogenum DSM 10061
49% identity, 47% coverage
- Clostridium autoethanogenum alters cofactor synthesis, redox metabolism, and lysine-acetylation in response to elevated H2:CO feedstock ratios for enhancing carbon capture efficiency
Davin, Biotechnology for biofuels and bioproducts 2024 - “...Aldehyde ferredoxin oxidoreductase 0.884 0.06 CAETHG_3358 phosphate acetyltransferase 0.004* 0.49 CAETHG_3359 Acetate kinase 0.934 0.01 CAETHG_0555 Alcohol dehydrogenase 0.983 0.01 CAETHG_1841 Alcohol dehydrogenase 0.062 0.41 CAETHG_3029 Pyruvate ferredoxin/flavodoxin oxidoreductase 0.031 0.44 CAETHG_0124 Acetolactate synthase 0.900 0.02 CAETHG_0125 Acetolactate synthase small subunit 0.087 0.26 CAETHG_0406 Acetolactate synthase...”
- Control of solvent production by sigma-54 factor and the transcriptional activator AdhR in Clostridium beijerinckii
Yang, Microbial biotechnology 2020 - “...adhP genes, CAETHG_0386 is involved in 2,3butanediol synthesis (Kopke et al. , 2011 ), and CLJU_c24880 and CLJU_c39950 are involved in butanol degradation (Tan et al. , 2014 ). Thus, SigL may play a role in regulation of alcohol metabolism in various Clostridium species. Experimental procedures...”
- “...and 12 elements upstream of CLSA_RS07875 gene from C.saccharobutylicum , Cspa_c27830 gene from C.saccharoperbutylacetonicum , CLJU_c24880 and CLJU_c39950 genes from C.ljungdahlii and CAETHG_0385 gene from C.autoethanogenum were chemically synthesized by GenScript. The DNA fragment containing the three UAS sites in the promoter region of adhA1 or...”
- Energy Conservation Associated with Ethanol Formation from H2 and CO2 in Clostridium autoethanogenum Involving Electron Bifurcation
Mock, Journal of bacteriology 2015 - “...C. ljungdahlii encoded by CLJU_c24880 (homologue of CAETHG_0555) and CLJU_c39950 (homologue of CAETHG_1841) (68). All three alcohol dehydrogenases have been...”
- “...butanol dehydrogenases of C. ljungdahlii encoded by CLJU_c24880 (homologue of CAETHG_0555) and CLJU_c39950 (homologue of CAETHG_1841) (68). All three alcohol...”
- Comparison of single-molecule sequencing and hybrid approaches for finishing the genome of Clostridium autoethanogenum and analysis of CRISPR systems in industrial relevant Clostridia
Brown, Biotechnology for biofuels 2014 - “...CAETHG_3747, 3748, E 2 Aldehyde:Fd oxidoreductase (AOR) CAETHG_0092, 0102, E 3 Additional alcohol dehydrogenases (Adh) CAETHG_0555. 2,3-butanediol fermentation pathway. B 1 Acetolactate synthase (AlsS) CAETHG_0124-25, 0406, 1740, B 2 Acetolactate decarboxylase (BudA) CAETHG_2932, B 3 2,3-butanediol dehydrogenase (Bdh) CAETHG_0385, Lactate fermentation pathway. L Lactate dehydrogenase (Ldh)...”
- Characterization of two novel butanol dehydrogenases involved in butanol degradation in syngas-utilizing bacterium Clostridium ljungdahlii DSM 13528
Tan, Journal of basic microbiology 2014 (PubMed)- “...DSM 13528. In this study two genes, CLJU_c24880 and CLJU_c39950, encoding putative butanol dehydrogenase (designated as BDH1 and BDH2) were identified...”
- “...three putative genes encoding butanol dehydrogenases (CLJU_c24880, CLJU_c39950 and CLJU_c23460) were identified. The mRNA abundances for CLJU_c24880 and...”
AHA_1331 alcohol dehydrogenase, iron-containing from Aeromonas hydrophila subsp. hydrophila ATCC 7966
48% identity, 47% coverage
- Transcriptome differences between enrofloxacin-resistant and enrofloxacin-susceptible strains of Aeromonas hydrophila
Zhu, PloS one 2017 - “...AHA_1687, AHA_4285, AHA_1595, and AHA_2813 (ABC transporters) were upregulated, while the AHA_1419 (environmental information processing), AHA_1331 (drug metabolism-cytochrome P450), AHA_2360, AHA_1331 (glycolysis/gluconeogenesis), and AHA_1331 (metabolism of xenobiotics by cytochrome P450) genes were downregulated. The ABC transporter genes were expressed at higher levels than drug metabolism-cytochrome P450,...”
CPAST_c33950 iron-containing alcohol dehydrogenase from Clostridium pasteurianum DSM 525 = ATCC 6013
48% identity, 47% coverage
Ethha_0051 iron-containing alcohol dehydrogenase from Ethanoligenens harbinense YUAN-3
49% identity, 46% coverage
Dde_3279 NAD-dependent aldehyde dehydrogenases from Desulfovibrio desulfuricans G20
45% identity, 50% coverage
SSA_0514 PduQ protein, putative from Streptococcus sanguinis SK36
47% identity, 46% coverage
- Involvement of NADH Oxidase in Biofilm Formation in Streptococcus sanguinis
Ge, PloS one 2016 - “...phosphate[ 42 ]. In S . sanguinis , the orthologs of eutE (SSA_0523) and eutG (SSA_0514) are present in the ethanolamine operon but eutD is missing. However, another phosphotransacetylase encoded by pduL (SSA_0527), which has been demonstrated in S . enterica subsp. enterica serovar Typhimurium [...”
Cspa_c27830 iron-containing alcohol dehydrogenase from Clostridium saccharoperbutylacetonicum N1-4(HMT)
49% identity, 45% coverage
Cphy_1029 iron-containing alcohol dehydrogenase from Clostridium phytofermentans ISDg
48% identity, 47% coverage
Ccar_25840 iron-containing alcohol dehydrogenase from Clostridium carboxidivorans P7
49% identity, 46% coverage
CLSA_RS07875 iron-containing alcohol dehydrogenase from Clostridium saccharobutylicum DSM 13864
49% identity, 45% coverage
Cbei_1722 iron-containing alcohol dehydrogenase from Clostridium beijerincki NCIMB 8052
49% identity, 45% coverage
- Control of solvent production by sigma-54 factor and the transcriptional activator AdhR in Clostridium beijerinckii
Yang, Microbial biotechnology 2020 - “...as C.beijerinckii . Among the 20 ADHencoding genes in C.beijerinckii , two genes (Cbei_2181 and Cbei_1722) encoding ironcontaining/activated ADHs were strongly induced at the onset of solvent production, suggesting that they are responsible for synthesis of butanol and ethanol (Wang, et al. , 2012 ). Unlike...”
- “...assays. We found that SigL is required for transcription of the adhA1 (Cbei_2181) and adhA2 (Cbei_1722) genes in C.beijerinckii . Then, a novel EBP, namely AdhR, was experimentally characterized as an activator of 54 dependent transcription of adhA1 and adhA2 . Furthermore, we studied the effects...”
- Ferrous-Iron-Activated Transcriptional Factor AdhR Regulates Redox Homeostasis in Clostridium beijerinckii
Yang, Applied and environmental microbiology 2020 (secret) - Acidogenesis, solventogenesis, metabolic stress response and life cycle changes in Clostridium beijerinckii NRRL B-598 at the transcriptomic level
Patakova, Scientific reports 2019 - “...who identified the two most transcribed iron-containing dehydrogenases that were homologous with identified bdh , Cbei_1722 and Cbei_2181 respectively 12 . Wang et al . (2012) described the abundance of isoenzymes in C . beijerinckii NCIMB 8052 sharing the same function but with altered expression patterns...”
- Genome and transcriptome of the natural isopropanol producer Clostridium beijerinckii DSM6423
Máté, BMC genomics 2018 - “...[ 8 ], out of the >20 genes encoding alcohol dehydrogenase in C. beijerinckii NCIMB8052, Cbei_1722 and Cbei_2181 were highly up-regulated at the onset of solventogenesis, corresponding to their key roles in primary alcohol production. In our fermentation experiments, the expression pattern of glycolysis genes was...”
- Transcriptional analysis of degenerate strain Clostridium beijerinckii DG-8052 reveals a pleiotropic response to CaCO3-associated recovery of solvent production
Jiao, Scientific reports 2016 - “...to play key roles in primary alcohol production of C. beijerinckii 8052 18 19 . Cbei_1722 and Cbei_2181 in DG-8052 with 9499% amino acid sequence identical to that of adhA and adhB , showed no change in their expression in response to CaCO 3 . The...”
- Redox-responsive repressor Rex modulates alcohol production and oxidative stress tolerance in Clostridium acetobutylicum
Zhang, Journal of bacteriology 2014 - “...Rex targets, the adhA (Cbei_2181) and adhA2 (Cbei_1722) genes encode two primary alcohol dehydrogenases responsible for production of butanol and ethanol...”
- Effects of supplementary butyrate on butanol production and the metabolic switch in Clostridium beijerinckii NCIMB 8052: genome-wide transcriptional analysis with RNA-Seq
Wang, Biotechnology for biofuels 2013 - “...related genes (Cbei_2609-2610) also demonstrated higher expression in R13. Comparatively, the primary alcohol dehydrogenase gene Cbei_1722 was at the same expression level in R13 and R24, while another primary alcohol dehydrogenase gene Cbei_2181 demonstrated two-fold higher expression in R13. More details concerning the expression dynamics of...”
- “...at highest levels thereafter (Figure 4 A). Two iron-containing alcohol dehydrogenase genes ( adh , Cbei_1722 and _2181) were inferred to play key roles during primary alcohol production in C. beijerinckii 8052 by comparing them with their previously characterized orthologs in C. beijerinckii NRRL B592 [...”
- Genome-wide dynamic transcriptional profiling in Clostridium beijerinckii NCIMB 8052 using single-nucleotide resolution RNA-Seq
Wang, BMC genomics 2012 - “...sol genes. Out of the > 20 genes encoding alcohol dehydrogenase in C. beijerinckii , Cbei_1722 and Cbei_2181 were highly up-regulated at the onset of solventogenesis, corresponding to their key roles in primary alcohol production. Most sporulation genes in C. beijerinckii 8052 demonstrated similar temporal expression...”
- “...were detected as highly expressed, including adc (Cbei_3835), thl (Cbei_0411), hbd (Cbei_0325), ald (Cbei_3832), adh (Cbei_1722), ctfB (Cbei_3834), ctfA (Cbei_3833) and buk (Cbei_0204). Highly expressed genes also included those encoding proteins that mediate electron transfer, such as Cbei_1416 (rubrerythrin), Cbei_0118, Cbei_3348 (desulfoferrodoxin), Cbei_4318, Cbei_4319 (flavodoxin), and...”
X276_18435 iron-containing alcohol dehydrogenase from Clostridium beijerinckii NRRL B-598
49% identity, 45% coverage
RUMGNA_01033 hypothetical protein from Ruminococcus gnavus ATCC 29149
46% identity, 47% coverage
CFX1CAM_1715 aldehyde dehydrogenase family protein from Brevefilum fermentans
44% identity, 50% coverage
CIBE_2622 iron-containing alcohol dehydrogenase from Clostridium beijerinckii
49% identity, 45% coverage
- σ54 (σL) plays a central role in carbon metabolism in the industrially relevant Clostridium beijerinckii
Hocq, Scientific reports 2019 - “...S2 ). In particular, two genes coding for strongly expressed 8 alcohol dehydrogenases (CIBE_2050 and CIBE_2622, which convert acetaldehyde and butyraldehyde into ethanol and butanol, respectively) 16 , 17 as well as the secondary alcohol dehydrogenase s-ADH encoding gene (CIBE_3470, whose product converts acetone to isopropanol)...”
- “..., 22 . Importantly, genes encoding 54 EBPs were found in the direct vicinity of CIBE_2622, CIBE_3470 and CIBE_1696, which strengthens the hypothesis of a 54 -driven transcriptional control of their expression. In order to investigate the functionality of the 54 -regulon, we used the synteny...”
- Genome and transcriptome of the natural isopropanol producer Clostridium beijerinckii DSM6423
Máté, BMC genomics 2018 - “...level of transcription was already observed at 3h for the predicted operons involved in butanol (CIBE_2622 to CIBE_2624), acetone (CIBE_4606 to CIBE_4609) or isopropanol (CIBE_3468 to CIBE_3470; Fig. 4 ) production. Expression of this latter operon was even up-regulated at 6h. This specificity confirm the distinct...”
Cphy_1421 iron-containing alcohol dehydrogenase from Clostridium phytofermentans ISDg
47% identity, 47% coverage
Cphy_1428 acetaldehyde dehydrogenase (acetylating) from Clostridium phytofermentans ISDg
45% identity, 51% coverage
Cbei_2181 iron-containing alcohol dehydrogenase from Clostridium beijerincki NCIMB 8052
49% identity, 45% coverage
- Control of solvent production by sigma-54 factor and the transcriptional activator AdhR in Clostridium beijerinckii
Yang, Microbial biotechnology 2020 - “...clostridia such as C.beijerinckii . Among the 20 ADHencoding genes in C.beijerinckii , two genes (Cbei_2181 and Cbei_1722) encoding ironcontaining/activated ADHs were strongly induced at the onset of solvent production, suggesting that they are responsible for synthesis of butanol and ethanol (Wang, et al. , 2012...”
- “...in vitro binding assays. We found that SigL is required for transcription of the adhA1 (Cbei_2181) and adhA2 (Cbei_1722) genes in C.beijerinckii . Then, a novel EBP, namely AdhR, was experimentally characterized as an activator of 54 dependent transcription of adhA1 and adhA2 . Furthermore, we...”
- Ferrous-Iron-Activated Transcriptional Factor AdhR Regulates Redox Homeostasis in Clostridium beijerinckii
Yang, Applied and environmental microbiology 2020 (secret) - Acidogenesis, solventogenesis, metabolic stress response and life cycle changes in Clostridium beijerinckii NRRL B-598 at the transcriptomic level
Patakova, Scientific reports 2019 - “...the two most transcribed iron-containing dehydrogenases that were homologous with identified bdh , Cbei_1722 and Cbei_2181 respectively 12 . Wang et al . (2012) described the abundance of isoenzymes in C . beijerinckii NCIMB 8052 sharing the same function but with altered expression patterns at different...”
- Genome and transcriptome of the natural isopropanol producer Clostridium beijerinckii DSM6423
Máté, BMC genomics 2018 - “...], out of the >20 genes encoding alcohol dehydrogenase in C. beijerinckii NCIMB8052, Cbei_1722 and Cbei_2181 were highly up-regulated at the onset of solventogenesis, corresponding to their key roles in primary alcohol production. In our fermentation experiments, the expression pattern of glycolysis genes was similar than...”
- Transcriptional analysis of degenerate strain Clostridium beijerinckii DG-8052 reveals a pleiotropic response to CaCO3-associated recovery of solvent production
Jiao, Scientific reports 2016 - “...key roles in primary alcohol production of C. beijerinckii 8052 18 19 . Cbei_1722 and Cbei_2181 in DG-8052 with 9499% amino acid sequence identical to that of adhA and adhB , showed no change in their expression in response to CaCO 3 . The aldehyde dehydrogenase...”
- Redox-responsive repressor Rex modulates alcohol production and oxidative stress tolerance in Clostridium acetobutylicum
Zhang, Journal of bacteriology 2014 - “...3). Among these candidate Rex targets, the adhA (Cbei_2181) and adhA2 (Cbei_1722) genes encode two primary alcohol dehydrogenases responsible for production of...”
- Effects of supplementary butyrate on butanol production and the metabolic switch in Clostridium beijerinckii NCIMB 8052: genome-wide transcriptional analysis with RNA-Seq
Wang, Biotechnology for biofuels 2013 - “...at the same expression level in R13 and R24, while another primary alcohol dehydrogenase gene Cbei_2181 demonstrated two-fold higher expression in R13. More details concerning the expression dynamics of these two primary alcohol dehydrogenase genes in the two reactors will be discussed later. Another alcohol dehydrogenase...”
- “...to the continuous solvent accumulation in R2. In addition, Cbei_1722 was comparatively higher regulated than Cbei_2181 in both reactors (2- to 6-fold higher in R1 and 4- to 22-fold higher in R2, respectively). It warrants further investigation whether this implies different significance or functions of these...”
- Genome-wide dynamic transcriptional profiling in Clostridium beijerinckii NCIMB 8052 using single-nucleotide resolution RNA-Seq
Wang, BMC genomics 2012 - “...Out of the > 20 genes encoding alcohol dehydrogenase in C. beijerinckii , Cbei_1722 and Cbei_2181 were highly up-regulated at the onset of solventogenesis, corresponding to their key roles in primary alcohol production. Most sporulation genes in C. beijerinckii 8052 demonstrated similar temporal expression patterns to...”
- “...(that is, butanol and ethanol, but not isopropanol) production [ 30 ]. The product of Cbei_2181 in C. beijerinckii 8052 exists 99% and 97% amino acid sequence identity to that of adhA and adhB , and the product of Cbei_1722 has 97% and 94% amino acid...”
CAETHG_3287, CLAU_3204 acetaldehyde dehydrogenase (acetylating) from Clostridium autoethanogenum DSM 10061
47% identity, 49% coverage
- Required Gene Set for Autotrophic Growth of Clostridium autoethanogenum
Woods, Applied and environmental microbiology 2022 - “...could be encoded by an estimated five genes within the C. autoethanogenum genome (CLAU_1772, CLAU_1783, CLAU_3204, CLAU_3655, CLAU_3656), none of which appears to be required under either growth condition. This could represent redundancy between these genes, which further knockout studies could aim to confirm, or it...”
- Agr Quorum Sensing influences the Wood-Ljungdahl pathway in Clostridium autoethanogenum
Piatek, Scientific reports 2022 - “...in alcoholformation included alcohol dehydrogenases (CLAU_1766 and 3861) and three, mono-functional, acetaldehyde dehydrogenases (CoA acetylating) (CLAU_3204, 1783 and 1772) 59 (Fig. 5 ), the genes of which are all linked to clusters encoding putative bacterial microcompartments (BMC). Given that some of the enzymes predicted to contribute...”
- Energy Conservation Associated with Ethanol Formation from H2 and CO2 in Clostridium autoethanogenum Involving Electron Bifurcation
Mock, Journal of bacteriology 2015 - “...that catalyze reaction 9 (CAETHG_1819, CAETHG_1830, and CAETHG_3287). All three are clustered with genes for microcompartment proteins and genes for...”
- Comparison of single-molecule sequencing and hybrid approaches for finishing the genome of Clostridium autoethanogenum and analysis of CRISPR systems in industrial relevant Clostridia
Brown, Biotechnology for biofuels 2014 - “...110 29 63 Complete None CAETHG_3286 3540008 3540784 Microcompartments protein 106 30 61 Complete None CAETHG_3287 3540833 3542350 Acetaldehyde dehydrogenase (acetylating) 111 27 61 Complete Partial Intergenic 3848150 3848350 NA 126 34 39 Complete None rRNA 3872016 3873511 16s_rRNA 98 10 18 None None rRNA 3873937...”
X276_15910 iron-containing alcohol dehydrogenase from Clostridium beijerinckii NRRL B-598
49% identity, 45% coverage
CIBE_2050 iron-containing alcohol dehydrogenase from Clostridium beijerinckii
48% identity, 45% coverage
- σ54 (σL) plays a central role in carbon metabolism in the industrially relevant Clostridium beijerinckii
Hocq, Scientific reports 2019 - “...(Supplementary File S2 ). In particular, two genes coding for strongly expressed 8 alcohol dehydrogenases (CIBE_2050 and CIBE_2622, which convert acetaldehyde and butyraldehyde into ethanol and butanol, respectively) 16 , 17 as well as the secondary alcohol dehydrogenase s-ADH encoding gene (CIBE_3470, whose product converts acetone...”
- “...measuring the stationary-phase expression of several genes ( ald : CIBE_4606; EBP-A: CIBE_2621; adh-1 : CIBE_2050; adh-2 : CIBE_2622; EBP-B: CIBE_3471; s-adh : CIBE_3470; sigL : CIBE_0767). Values are given relative to the AA pFW01 expression value. Error bars indicate the standard deviation of triplicate experiments,...”
CBY_3747 NADPH-dependent butanol dehydrogenase from Clostridium butyricum 5521
47% identity, 47% coverage
- Reduced catabolic protein expression in Clostridium butyricum DSM 10702 correlate with reduced 1,3-propanediol synthesis at high glycerol loading
Gungormusler-Yilmaz, AMB Express 2014 - “...2.44 2.19 CBY_3691 dihydroxyacetone kinase (DhaK subunit) 0.42 0.58 0.79 0.81 NQ NQ NQ NQ CBY_3747 NADPH-dependent butanol dehydrogenase 0.35 1.12 0.12 1.61 0.13 0.22 1.01 1.11 CBY_3751 NADPH-dependent butanol dehydrogenase 0.23 0.08 0.36 0.26 0.53 0.18 0.57 0.94 CBY_3753 Ethanol dehydrogenase (aldehyde-alcohol dehydrogenase 2) 2.58...”
- “...dehydratase (CBY_3041), acyl-CoA dehydrogenase (CBY_3258 and 3042), phosphate butyryltransferase (CBY_2919), butyrate kinase (CBY_2920), butanol dehydrogenase (CBY_3747 and 3751), phosphate acetyltransferase (CBY_0205), acetate kinase (CBY_0206), lactate dehydrogenase (CBY_0742, 2341 and 2757), and ethanol dehydrogenase (CBY_3753) (Figure 2 and Table 2 ). Figure 1 Growth curves, pH profiles,...”
CAETHG_1819, CLAU_1772 acetaldehyde dehydrogenase (acetylating) from Clostridium autoethanogenum DSM 10061
47% identity, 49% coverage
- The role of ethanol oxidation during carboxydotrophic growth of Clostridium autoethanogenum
Diender, Microbial biotechnology 2023 - “...one additional AdhE with an Ald subunit (AdhE2, CAETHG_3748) and three additional monofunctional Ald genes (CAETHG_1819, 1830 & 3287), associated with gene clusters for bacterial microcompartments (BMCs), whose contribution to central carbon metabolism during growth on CO is not clear (Piatek et al., 2022 ). The...”
- Required Gene Set for Autotrophic Growth of Clostridium autoethanogenum
Woods, Applied and environmental microbiology 2022 - “...1.2.1.10), which could be encoded by an estimated five genes within the C. autoethanogenum genome (CLAU_1772, CLAU_1783, CLAU_3204, CLAU_3655, CLAU_3656), none of which appears to be required under either growth condition. This could represent redundancy between these genes, which further knockout studies could aim to confirm,...”
- Agr Quorum Sensing influences the Wood-Ljungdahl pathway in Clostridium autoethanogenum
Piatek, Scientific reports 2022 - “...cluster were found to have enhanced abundances in this analysis for the agrD1D2 mutant (CLAU_1769, CLAU_1772, CLAU_1773, CLAU_1775 and CLAU_1785), along with 1,2-propanediol and two ethanolamine-utilising enzymes, PduL, EutQ and EutJ (CLAU_1771, CLAU_1774 and CLAU_1779) respectively. A second BMC cluster with enhanced abundances, represented another BMC...”
- Metabolic engineering of Clostridium autoethanogenum for selective alcohol production
Liew, Metabolic engineering 2017 - “...phase. In addition to the two adhE genes, there are 3 other mono-functional ald genes (CLAU_1772, 1783 & 3204) in the genome of C. autoethanogenum . Accordingly, the generation of a triple ald KO strain may further channel carbon and electrons towards acetate synthesis and ethanol...”
- Energy Conservation Associated with Ethanol Formation from H2 and CO2 in Clostridium autoethanogenum Involving Electron Bifurcation
Mock, Journal of bacteriology 2015 - “...dehydrogenases (CoA acetylating) that catalyze reaction 9 (CAETHG_1819, CAETHG_1830, and CAETHG_3287). All three are clustered with genes for microcompartment...”
- “...and genes for ethanolamine or propanediol utilization. Genes CAETHG_1819 and CAETHG_3287 share 98% sequence identity on the nucleotide level. In each of the two...”
- Comparison of single-molecule sequencing and hybrid approaches for finishing the genome of Clostridium autoethanogenum and analysis of CRISPR systems in industrial relevant Clostridia
Brown, Biotechnology for biofuels 2014 - “...19 81 Complete None CAETHG_1818 1956948 1957598 Propanediol utilization protein 144 24 74 Complete None CAETHG_1819 1957600 1959153 Acetaldehyde dehydrogenase (acetylating) 153 25 67 Complete None CAETHG_1826 1963196 1964038 Ethanolamine utilization protein EutJ family protein 161 34 73 Complete Partial CAETHG_1827 1964020 1964790 Hypothetical protein 162...”
CBY_3751 NADPH-dependent butanol dehydrogenase from Clostridium butyricum 5521
48% identity, 45% coverage
- Reduced catabolic protein expression in Clostridium butyricum DSM 10702 correlate with reduced 1,3-propanediol synthesis at high glycerol loading
Gungormusler-Yilmaz, AMB Express 2014 - “...NQ NQ NQ CBY_3747 NADPH-dependent butanol dehydrogenase 0.35 1.12 0.12 1.61 0.13 0.22 1.01 1.11 CBY_3751 NADPH-dependent butanol dehydrogenase 0.23 0.08 0.36 0.26 0.53 0.18 0.57 0.94 CBY_3753 Ethanol dehydrogenase (aldehyde-alcohol dehydrogenase 2) 2.58 1.08 2.61 4.78 0.27 0.12 0.15 0.01 CBY_9999 glycerol uptake facilitator protein...”
- “...Table 2 , one putative alcohol dehydrogenase (CBY_3747) was down-regulated, while another putative alcohol dehydrogenase (CBY_3751) was up-regulated, in the higher initial glycerol concentration cultures (Figure 1 c). The putative ethanol synthesizing alcohol dehydrogenase, AdhE (encoded by CBY_3753), was expressed at higher levels during both exponential...”
GM661_12235 iron-containing alcohol dehydrogenase from Iocasia fonsfrigidae
50% identity, 47% coverage
CLAU_1766 1-propanol dehydrogenase PduQ from Clostridium autoethanogenum DSM 10061
45% identity, 47% coverage
Dde_3267 Alcohol dehydrogenase, class IV from Desulfovibrio desulfuricans G20
46% identity, 47% coverage
- The genetic basis of energy conservation in the sulfate-reducing bacterium Desulfovibrio alaskensis G20
Price, Frontiers in microbiology 2014 - “...the acetyl-CoA is converted to acetate and ATP by genes within the microcompartment (Dde_3283, Dde_3279, Dde_3267, and Dde_3276 in Figure 3 ). The ethanol probably diffuses to the cytoplasm and is utilized as under ethanol/sulfate conditions, which explains why the cytoplasmic aldehyde:ferredoxin oxidoreductase (Dde_2460) is important...”
- “...or higher, and none of these seem related to energy production ( ilvB , tadE (Dde_3267), spoT , gpsA , and murein transglycosylase Dde_3580). Two base media formulations were usedHazen and MO media. Hazen media was used for 16 fitness experiments; MO media was used for...”
CLAU_1783 aldehyde dehydrogenase family protein from Clostridium autoethanogenum DSM 10061
42% identity, 50% coverage
- Required Gene Set for Autotrophic Growth of Clostridium autoethanogenum
Woods, Applied and environmental microbiology 2022 - “...which could be encoded by an estimated five genes within the C. autoethanogenum genome (CLAU_1772, CLAU_1783, CLAU_3204, CLAU_3655, CLAU_3656), none of which appears to be required under either growth condition. This could represent redundancy between these genes, which further knockout studies could aim to confirm, or...”
NL43_02830 iron-containing alcohol dehydrogenase from Methanosphaera sp. WGK6
47% identity, 45% coverage
EUBSIR_02124 hypothetical protein from Eubacterium siraeum DSM 15702
45% identity, 47% coverage
- Vesiculation from Pseudomonas aeruginosa under SOS
Maredia, TheScientificWorldJournal 2012 - “...HypotheticalSfum_2918 [ Syntrophobacter fumaroxidans MPOB] 54 5.40 89798 Carbohydrate binding SP, TM (138) gi167751139 Hypothetical EUBSIR_02124 [ Eubacterium siraeum DSM 15702] 53 5.50 44267 Metal ion binding n, TM (139) gi26250264 Hypotheticalc4442 [ E. coli CFT073] 53 9.39 39090 Unknown n, TM (140) gi167754381 Hypothetical ALIPUT_02675...”
Rru_A0904 Iron-containing alcohol dehydrogenase from Rhodospirillum rubrum ATCC 11170
44% identity, 47% coverage
- The metabolic pathways of carbon assimilation and polyhydroxyalkanoate production by Rhodospirillum rubrum in response to different atmospheric fermentation
Tang, PloS one 2024 - “...coding for aldehyde dehydrogenase ( Rru_A0656 , Rru_A1542 , Rru_A0914 ), iron-containing alcohol dehydrogenases ( Rru_A0904 ) and several NADH dehydrogenases (e.g., Rru_A0320 , Rru_A0314 , Rru_A0321 , etc.), which are belonging to the reactive oxygen species (ROS) detox system, were significantly induced ( S1 Appendix...”
FC61_GL001110 1-propanol dehydrogenase PduQ from Levilactobacillus brevis ATCC 14869 = DSM 20054
42% identity, 47% coverage
EF1635 propanol dehydrogenase PduQ, putative from Enterococcus faecalis V583
44% identity, 46% coverage
Dde_3283 NAD-dependent aldehyde dehydrogenases from Desulfovibrio desulfuricans G20
40% identity, 52% coverage
lin1130 similar to NADPH-dependent butanol dehydrogenase from Listeria innocua Clip11262
45% identity, 47% coverage
CAY53_10125 iron-containing alcohol dehydrogenase from Desulfobulbus oralis
43% identity, 47% coverage
lmo1166 similar to NADPH-dependent butanol dehydrogenase from Listeria monocytogenes EGD-e
45% identity, 47% coverage
- Anti-Biofilm Effects of Z102-E of Lactiplantibacillus plantarum against Listeria monocytogenes and the Mechanism Revealed by Transcriptomic Analysis
Wei, Foods (Basel, Switzerland) 2024 - “...protein LM700514_40645 [ Listeria monocytogenes ] 0.057 4.133942 lmo1161 ethanolamine utilization protein EutJ 0.06 4.054854 lmo1166 NADPH-dependent butanol dehydrogenase 0.064 3.963328 lmo1155 diol dehydratase subunit gamma 0.07 3.842152 lmo1159 carboxysome structural protein 0.07 3.827296 lmo1160 PduL protein 0.073 3.778299 lmo1163 carbon dioxide concentrating mechanism protein 0.081...”
- Anaerobic Growth of Listeria monocytogenes on Rhamnose Is Stimulated by Vitamin B12 and Bacterial Microcompartment-Dependent 1,2-Propanediol Utilization
Zeng, mSphere 2021 - “...33 ) suggests four putative candidates annotated as alcohol dehydrogenase in L. monocytogenes EGDe, including lmo1166, lmo1171, lmo1634, and lmo1737, detected in the proteomes of both pdu -noninduced and pdu -induced cells (for details see Text S1 in the supplemental material). Since the discovery of the...”
- Sublethal Concentrations of Antibiotics Cause Shift to Anaerobic Metabolism in Listeria monocytogenes and Induce Phenotypes Linked to Antibiotic Tolerance
Knudsen, Frontiers in microbiology 2016 - “...an aldehyde oxidoreductase. The ADH domain of lmo1634 has three homologies ( eutG or lmo1171, lmo1166 , and lmo1165 ) with E-values between 4e -44 and 2e -88 (between 3141% identity with 4546% coverage). These four genes ( lmo1165, lmo1166, lmo1171 , and lmo1179 ) are...”
- “...ethanolamine to ethanol and acetyl-CoA. Neither of the four genes lmo1179, lmo1171, lmo1165 , or lmo1166 (gray) are differentially expressed by any of the four antibiotics. We suggest that L. monocytogenes EGD shift to anaerobic condition and production of ethanol to avoid respiration. During aerobic respiration,...”
- Deciphering the intracellular metabolism of Listeria monocytogenes by mutant screening and modelling
Schauer, BMC genomics 2010 - “...1.0 2 lmo1032 Transketolase rf 14.4 4 lmo0590 hypothetical DAK2/DegV domain-containing protein possible 9.6 1.0 lmo1166 NADPH-dependent butanol dehydrogenaseI possible 4.2 1.0 lmo0765 unknown protein possible 10.4 3.0 4 glpD (lmo1293) glycerol-3-phosphate dehydrogenase no 4.8 1.0 4,6,7 lmo0794 B. subtilis YwnB protein no 12.4 2.0 6...”
- A postgenomic appraisal of osmotolerance in Listeria monocytogenes
Sleator, Applied and environmental microbiology 2003 - “...(lmo0913, lmo0383, and lmo1179) and gbsB (pduQ, lmo1634, lmo1166, and lmo0554), encoding a glycine betaine aldehyde dehydrogenase and a type III alcohol...”
KO21_RS06065 1-propanol dehydrogenase PduQ from Listeria monocytogenes
45% identity, 47% coverage
CD630_23420, CDIF630erm_02581 aldehyde dehydrogenase family protein from Clostridioides difficile 630
CD2342 succinate-semialdehyde dehydrogenase (NAD(P)+) from Clostridium difficile 630
41% identity, 51% coverage
- Iron Regulation in Clostridioides difficile
Berges, Frontiers in microbiology 2018 - “...CDIF630erm_02579 Hypothetical protein -2.16 -1.55 CD630_23410 CDIF630erm_02580 abfD Gamma-aminobutyrate metabolism dehydratase/isomerase -1.41 -1.74 -1.23 -1.16 CD630_23420 CDIF630erm_02581 sucD Succinate-semialdehyde dehydrogenase -2.47 -3.77 CD630_23430 CDIF630erm_02582 cat1 Succinyl-CoA:coenzyme A transferase -3.35 -3.58 CD630_23440 CDIF630erm_02583 Membrane protein -4.79 -5.28 CD630_23480 CDIF630erm_02587 grdD Glycine reductase complex component D OFF OFF...”
- “...Hypothetical protein -2.16 -1.55 CD630_23410 CDIF630erm_02580 abfD Gamma-aminobutyrate metabolism dehydratase/isomerase -1.41 -1.74 -1.23 -1.16 CD630_23420 CDIF630erm_02581 sucD Succinate-semialdehyde dehydrogenase -2.47 -3.77 CD630_23430 CDIF630erm_02582 cat1 Succinyl-CoA:coenzyme A transferase -3.35 -3.58 CD630_23440 CDIF630erm_02583 Membrane protein -4.79 -5.28 CD630_23480 CDIF630erm_02587 grdD Glycine reductase complex component D OFF OFF CD630_23490...”
- Global transcriptional control by glucose and carbon regulator CcpA in Clostridium difficile
Antunes, Nucleic acids research 2012 - “...hbd (CD1058), 3-hydroxybutyryl-CoA dehydrogenase; crt2 (CD1057), 3-hydroxybutyryl-CoA dehydratase; cat1 (CD2343), succinyl-CoA: coenzyme A transferase; sucD (CD2342), succinate-semialdehyde dehydrogenase; 4hbd (CD2338), 4-hydroxybutyrate dehydrogenase; cat2 (CD2339), 4-hydroxybutyrate CoA transferase; abfD (CD2341), vinylacetyl-coa--isomerase; bcd2 (CD1054), butyryl-CoA dehydrogenase; etfBA (CD1055CD1056), electron transfer flavoproteins; ptb (CD0715, CD0112), phosphate butyryltransferase; buk (CD0113),...”
- Temporal differential proteomes of Clostridium difficile in the pig ileal-ligated loop model
Janvilisri, PloS one 2012 - “...Among others, proteins involved in the succinate fermentation to butyrate pathway including AbfD (CD2341), SucD (CD2342), and Cat1 (CD2343) showed a decrease in abundance whereas proteins in pyruvate fermentation to acetate pathway including Pyc (CD0021), and PflD (CD3282) were up-regulated. Interestingly, expression of the proteins in...”
LF82_344 1-propanol dehydrogenase PduQ from Escherichia coli LF82
43% identity, 46% coverage
8cejA / P38947 Succinyl-coa reductase from clostridium kluyveri (sucd) with mesaconyl-c1-coa (see paper)
41% identity, 51% coverage
- Ligand: (2e)-2-methylbut-2-enedioic acid (8cejA)
sucD / P38947 succinate semialdehyde dehydrogenase subunit (EC 1.2.1.76) from Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) (see 3 papers)
sucD / GB|AAA92347.1 succinate-semialdehyde dehydrogenase [NAD(P)+]; EC 1.2.1.16 from Clostridium kluyveri DSM 555 (see paper)
P38947 Succinate-semialdehyde dehydrogenase (acetylating) from Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NBRC 12016 / NCIMB 10680 / K1)
41% identity, 51% coverage
- Enhancing the Substrate Specificity of Clostridium Succinyl-CoA Reductase for Synthetic Biology and Biocatalysis
Pfister, Biochemistry 2023 - “...CkSucD are 8CEI (without ligands), 8CEK (with NADPH), and 8CEJ (with mesaconyl-C1-CoA). Uniprot IDs are P38947 for CkSucD and A0A031WJ42 for CdSucD. Author Contributions P.P. and C.D. contributed equally to this work. P.P., C.D., and T.J.E. conceived the project. P.P., M.C., C.D., and E.H. performed kinetic...”
- Systematic Analysis of Metabolic Pathway Distributions of Bacterial Energy Reserves
Wang, G3 (Bethesda, Md.) 2019 - “...Malonyl CoA-acyl carrier protein transacylase 209 P0AAI9 PF00698 Clostridium kluyveri sucD Succinic semialdehyde dehydrogenase 453 P38947 PF00171 Clostridium kluyveri 4hbD NAD-dependent 4-hydroxybutyrate dehydrogenase 371 P38945 PF00465 Clostridium kluyveri orfZ 4-Hydroxybutyrate CoA-transferase 437 A0A1L5FD42 PF02550, PF13336 Saccharomyces cerevisiae PDAT ^ Phospholipid: diacylglycerol acyltransferase 661 P40345 PF02450 Acinetobacter...”
- The ald gene, encoding a coenzyme A-acylating aldehyde dehydrogenase, distinguishes Clostridium beijerinckii and two other solvent-producing clostridia from Clostridium acetobutylicum
Toth, Applied and environmental microbiology 1999 - “...(U93353) and the succinate-semialdehyde dehydrogenase of Clostridium kluyveri (P38947), with E values of 4 1048 to 4 103. (iii) Between residue 60 and the...”
- “...region Accession no. L06902 AAA80209 Q24803 U93353 P38947 P33744 P17547 CAA04467 P11883 a Abbreviations: Aad, AdhE, and Adh2, aldehyde-alcohol dehydrogenases;...”
WP_012457729 aldehyde dehydrogenase family protein from Porphyromonas gingivalis
PGN_0723 succinate-semialdehyde dehydrogenase from Porphyromonas gingivalis ATCC 33277
40% identity, 51% coverage
- Acyl-CoA reductase PGN_0723 utilizes succinyl-CoA to generate succinate semialdehyde in a butyrate-producing pathway of Porphyromonas gingivalis.
Yoshida, Archives of biochemistry and biophysics 2016 (PubMed)- GeneRIF: PGN_0723 produces succinate semialdehyde, which is an intermediate in the P. gingivalis butyrate synthesis pathway, not from succinate but from succinyl-CoA in the presence of NAD(P)H via a ping-pong bi-bi mechanism.
- Post-translational Modifications in Oral Bacteria and Their Functional Impact
Ma, Frontiers in microbiology 2021 - “...protein succinylation and acetylation were extensively overlapped in P. gingivalis , including PGN_0377, PGN_0457, PGN_0497, PGN_0723, PGN_0724, PGN_0725, PGN_1176, PGN_1178, PGN_1341, and PGN_1367, which play a crucial role in the ribosome and metabolic processes ( Zeng et al., 2020 ). S -glutathionylation is the specific PTM...”
- Acyl-CoA reductase PGN_0723 utilizes succinyl-CoA to generate succinate semialdehyde in a butyrate-producing pathway of Porphyromonas gingivalis
Yoshida, Archives of biochemistry and biophysics 2016 (PubMed)- “...PGN_0723 utilizes succinyl-CoA to generate succinate semialdehyde in a butyrate-producing pathway of Porphyromonas gingivalis Archives of Biochemistry and Biophysics Journal 00039861 596 138...”
- “...showed that the amino acid sequence of PGN_0723 protein was 50.6% identical with CoA-dependent succinate semialdehyde dehydrogenase (SSADH) in Clostridium...”
PG0687 succinate-semialdehyde dehydrogenase from Porphyromonas gingivalis W83
40% identity, 51% coverage
- Metabolic cooperativity between Porphyromonas gingivalis and Treponema denticola
Kin, Journal of oral microbiology 2020 - “...( Figure 1 ). These genes are all transcribed from the one operon comprising PG0692 PG0687 with genes encoding succinate semialdehyde reductase ( PG0689 ; [ 44 ]) and 4-hydroxybutyryl-CoA dehydratase ( PG0692 ) significantly upregulated by 1.66- and 2.09-fold, respectively, whilst genes encoding succinyl CoA...”
- Microarray analysis of the transcriptional responses of Porphyromonas gingivalis to polyphosphate
Moon, BMC microbiology 2014 - “...dehydrogenase 1.52 PG2121 L-asparaginase 1.51 PG0025 Fumarylacetoacetate hydrolase family protein 2.11 Energy metabolism : Anaerobic/Fermentation PG0687 Succinate-semialdehyde dehydrogenase 1.76 PG0690 4-hydroxybutyrate CoA-transferase 1.66 PG0689 NAD-dependent 4-hydroxybutyrate dehydrogenase 1.58 PG1609 Methylmalonyl-CoA decarboxylase, gamma subunit 1.87 PG1612 Methylmalonyl-CoA decarboxylase, alpha subunit 1.71 PG1608 Methylmalonyl-CoA decarboxylase, beta subunit 1.64...”
- Response of Porphyromonas gingivalis to heme limitation in continuous culture
Dashper, Journal of bacteriology 2009 - “...heme excessa Product no. TIGR accession no. PG032 2 PG0548 3 PG0687 4 PG0689 5 6 7 PG0690h PG0691h PG0692 8 PG1067 9 PG1068 10 11 PG1075h PG1076 12 PG1078 13 14...”
- “...catabolic pathways. Enzymes of the glutamate pathway, encoded by PG0687 to PG0692, which FIG. 4. P. gingivalis W50 (}) and ECR312 (f) binding to KB cells. The...”
- Gene expression profile analysis of Porphyromonas gingivalis during invasion of human coronary artery endothelial cells
Rodrigues, Infection and immunity 2005 - “...PG0288 PG0315 PG0375 PG0389 PG0390 PG0392 PG0616 PG0618 PG0687 PG0689 PG0762 PG0779 PG0780 PG0992 PG1078 PG1084 PG1105 PG1153 PG1189 PG1256 PG1265 PG1304 PG1492...”
PDUQ_CITFR / B1VB76 1-propanol dehydrogenase PduQ; Propanediol utilization protein PduQ; EC 1.1.-.- from Citrobacter freundii (see paper)
43% identity, 46% coverage
- function: An iron-dependent alcohol dehydrogenase required for optimal 1,2-propanediol (1,2-PD) degradation. NAD(+) and NADH are regenerated internally within the bacterial microcompartment (BMC) dedicated to 1,2-PD degradation by the PduP and PduQ enzymes, which reduce NAD(+) and oxidize NADH respectively, although there must also be cofactor transport across the BMC.
function: Expression of a cosmid containing the full 21-gene pdu operon in E.coli allows E.coli to grow on 1,2-propanediol (1,2-PD) with the appearance of bacterial microcompartments (BMC) in its cytoplasm.
function: The 1,2-PD-specific bacterial microcompartment (BMC) concentrates low levels of 1,2-PD catabolic enzymes, concentrates volatile reaction intermediates thus enhancing pathway flux and keeps the level of toxic, mutagenic propionaldehyde low.
catalytic activity: 1-propanol + NAD(+) = propanal + NADH + H(+) (RHEA:50704)
cofactor: Fe cation
subunit: Interacts with PduP, probably via the N-terminus of PduQ.
EUCAFD_37320, EUCAMar_27100 1-propanol dehydrogenase PduQ from Eubacterium callanderi
42% identity, 47% coverage
- Refining and illuminating acetogenic Eubacterium strains for reclassification and metabolic engineering
Flaiz, Microbial cell factories 2024 - “...not described to produce butanol, but at least four alcohol dehydrogenase are annotated (EUCAFD_23750, EUCAFD_27570, EUCAFD_37320, EUCAFD_40080). Finally, it should be mentioned that microscopic examinations provided no indication that cells of any Eubacterium strain sporulate during the performed growth experiments. This result was confirmed by genome...”
- “...Identical gene sequences are present in the genome of strain Marburg (DSM 3468) (EUCAMar_37310, EUCAMar_01710, EUCAMar_27100, EUCAMar_29180, EUCAMar_18280). The type strain of E.callanderi (DSM 3662 T ) is not described to produce butanol, but at least four alcohol dehydrogenase are annotated (EUCAFD_23750, EUCAFD_27570, EUCAFD_37320, EUCAFD_40080). Finally,...”
B2M23_02350 1-propanol dehydrogenase PduQ from Eubacterium limosum
42% identity, 47% coverage
- Refining and illuminating acetogenic Eubacterium strains for reclassification and metabolic engineering
Flaiz, Microbial cell factories 2024 - “...(DSM 20543 T ) encodes three alcohol dehydrogenases (B2M23_09455, B2M23_12405, B2M23_15170) and a butanol dehydrogenase (B2M23_02350), which might convert butyraldehyde to butanol and two aldehyde:ferredoxin oxidoreductases (B2M23_16025, B2M23_04655), potentially converting butyrate to butyraldehyde. Same genes are annotated in strain B2; three alcohol dehydrogenases (M5595_07965, M5595_18545, M5595_00635),...”
Entcl_1745 1-propanol dehydrogenase PduQ from [Enterobacter] lignolyticus SCF1
42% identity, 46% coverage
- Multi-time series RNA-seq analysis of Enterobacter lignolyticus SCF1 during growth in lignin-amended medium
Orellana, PloS one 2017 - “...encoded by Entcl_0583, Entcl_1740, and Entcl_1433; (23) Acetaldehyde dehydrogenase, EC 1.2.1.10, encoded by Entcl_2072, and Entcl_1745; (24) Alcohol dehydrogenase, EC 1.1.1.1, encoded by Entcl_2072, Entcl_0739, Entcl_1314, Entcl_1745, Entcl_3458, and Entcl_4294; (25) Xylose Isomerase, EC 5.3.1.5, encoded by Entcl_0177; (26) Xylulose kinase, EC 2.7.1.17, encoded by Entcl_0178;...”
C4M7F5 Alcohol dehydrogenase, putative from Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
EHI_166490 alcohol dehydrogenase, putative from Entamoeba histolytica HM-1:IMSS
38% identity, 47% coverage
- Unraveling the relevance of the polyadenylation factor EhCFIm25 in Entamoeba histolytica through proteomic analysis
Salgado-Martínez, FEBS open bio 2021 - “...XP_652300.1 ADHE 3.338295165 2.276880037 1.061415128 EHI_125950 C4LVY0 XP_650419.1 Alcohol dehydrogenase_putative (ADH) 2.493758657 1.026187504 1.467571153 EHI_166490 C4M7F5 XP_652262.2 Alcohol dehydrogenase_putative (ADH) 1.048881287 1.286563624 0.237682337 EHI_198620 C4LWQ8 XP_655201.2 PPiPEPCK3 8.318126762 5.902664315 2.415462446 EHI_044970 Q9NH04 XP_648590.1 ME 3.371544637 2.282862579 1.088682059 EHI_014410 B1N2Y0 XP_001913546.1 MDH_ putative 2.539964263 1.29009284 1.249871423 EHI_070720...”
- “...synthetase_ putative (C4LUV9) (ACD) and the reduced amount of bifunctional ADHE (C4M230), and C4LVY0 and C4M7F5, two putative alcohol dehydrogenases of 42kDa and 46kDa, respectively, that did not correspond to the reported ADH1 (39kDa) and ADH3 (43kDa), suggested that parasites direct the last steps of glycolysis...”
- Unraveling the relevance of the polyadenylation factor EhCFIm25 in Entamoeba histolytica through proteomic analysis
Salgado-Martínez, FEBS open bio 2021 - “...C4M230 XP_652300.1 ADHE 3.338295165 2.276880037 1.061415128 EHI_125950 C4LVY0 XP_650419.1 Alcohol dehydrogenase_putative (ADH) 2.493758657 1.026187504 1.467571153 EHI_166490 C4M7F5 XP_652262.2 Alcohol dehydrogenase_putative (ADH) 1.048881287 1.286563624 0.237682337 EHI_198620 C4LWQ8 XP_655201.2 PPiPEPCK3 8.318126762 5.902664315 2.415462446 EHI_044970 Q9NH04 XP_648590.1 ME 3.371544637 2.282862579 1.088682059 EHI_014410 B1N2Y0 XP_001913546.1 MDH_ putative 2.539964263 1.29009284 1.249871423...”
- An Alcohol Dehydrogenase 3 (ADH3) from Entamoeba histolytica Is Involved in the Detoxification of Toxic Aldehydes
König, Microorganisms 2020 - “...surface proteome of E. histolytica . Besides EhADH3B b , EhADH2 (EHI_150490), EhADH3A, EhADH3C and EHI_166490 were detected in the surface proteome [ 19 ]. The surface localization of EhADH3A was confirmed by staining the surface of live amoebae using an EhADH3A specific antibody [ 15...”
- “...20 ] EHI_125950 (EhADH3C) 383 Fe-ADH EHI_192470 (EhADH3D) 382 Fe-ADH Undetermined EHI_000410 360 Fe-ADH superfamily EHI_166490 419 1 Bifunctional ADHE EHI_150490: 52% (C-terminus) 1 Incompletely sequenced (AmoebaDB, release 48 beta, 27 August 2020), 2 see this study. microorganisms-08-01608-t002_Table 2 Table 2 Amino acid sequence identity of...”
- A Multilocus Sequence Typing System (MLST) reveals a high level of diversity and a genetic component to Entamoeba histolytica virulence
Gilchrist, BMC microbiology 2012 - “...TC TC TC TC XM_647310 EHI_046600 6048 A A A C C C C XM_647170 EHI_166490 28371 G G G/A G G G/A G/A XM_652055 EHI_049680 91356 A A A A A C C XM_648588 EHI_188130 32841 C C C T T T T XM_001914355 EHI_083760...”
c4524 Putative propanol dehydrogenase from Escherichia coli CFT073
40% identity, 46% coverage
B5RBP2 Putative propanol dehydrogenase from Salmonella gallinarum (strain 287/91 / NCTC 13346)
43% identity, 45% coverage
- Using the Yeast Three-Hybrid System to Identify Proteins that Interact with a Phloem-Mobile mRNA.
Cho, Frontiers in plant science 2012 - “...2004 ; Doroshenk et al., 2009 ; Ling et al., 2011 ), and three others, B5RBP2, -5, and -7, contain conserved RNA recognition motifs (RRMs; Figure 3 ). The most frequently identified clone from the Y3H screening, StLSH10 (B5RBP3), was also included (Table A3 in Appendix)....”
- “...KOW, from Kyrpides et al. ( 1996 ); CC, coiled-coil motif; ZF-CCCH, zinc finger, CCCH-type. B5RBP2 encodes a glycine-rich RNA-binding protein that contains a RRM for RNA-binding and a glycine-rich motif (GRM, Figure 3 ). Plant proteins that contain a GRM are grouped into five classes...”
pduQ / Q9XDN0 propanol dehydrogenase (EC 1.1.1.1) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
PDUQ_SALTY / Q9XDN0 1-propanol dehydrogenase PduQ; Propanediol utilization protein PduQ; EC 1.1.-.- from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 3 papers)
NP_460997 propanediol utilization propanol dehydrogenase from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
STM2052 Propanediol utilization: propanol dehydrogenase from Salmonella typhimurium LT2
42% identity, 46% coverage
- function: An iron-dependent alcohol dehydrogenase required for optimal 1,2-propanediol (1,2-PD) degradation. NAD(+) and NADH are regenerated internally within the bacterial microcompartment (BMC) dedicated to 1,2-PD degradation by the PduP and PduQ enzymes, which reduce NAD(+) and oxidize NADH respectively, although there must also be cofactor transport across the BMC.
function: The 1,2-PD-specific bacterial microcompartment (BMC) concentrates low levels of 1,2-PD catabolic enzymes, concentrates volatile reaction intermediates thus enhancing pathway flux and keeps the level of toxic, mutagenic propionaldehyde low.
catalytic activity: 1-propanol + NAD(+) = propanal + NADH + H(+) (RHEA:50704)
cofactor: Fe cation
subunit: Interacts with PduP, probably via the N-terminus of PduQ.
disruption phenotype: Loss of NADH-dependent reduction of propionaldehyde in BMCs. BMCs appear to be normal, cells grow more slowly on 1,2-PD with limiting or saturating CN-B12. - The PduQ enzyme is an alcohol dehydrogenase used to recycle NAD+ internally within the Pdu microcompartment of Salmonella enterica.
Cheng, PloS one 2012 - GeneRIF: The pduQ protein of S. enterica is an iron-dependent alcohol dehydrogenase used for 1,2-propanediol catabolism.
- Salmonella serovar identification using PCR-based detection of gene presence and absence
Arrach, Journal of clinical microbiology 2008 - “...STM1868, STM2007, STM2008, STM2026, STM2050, STM2051, STM2052, STM2084, STM2085, STM2092, STM2099, STM2133, STM2135, STM2151, STM2152, STM2232, STM2240,...”
HMPREF0397_RS02835 1-propanol dehydrogenase PduQ from Fusobacterium nucleatum subsp. nucleatum ATCC 23726
44% identity, 47% coverage
Awo_c06220 1-propanol dehydrogenase PduQ from Acetobacterium woodii DSM 1030
42% identity, 47% coverage
Csac_0407 Alcohol dehydrogenase from Caldicellulosiruptor saccharolyticus DSM 8903
43% identity, 47% coverage
R2XKF7 Aldehyde dehydrogenase domain-containing protein from Enterococcus gilvus ATCC BAA-350
38% identity, 50% coverage
- Study of sulfoglycolysis in <i>Enterococcus gilvus</i> reveals a widespread bifurcated pathway for dihydroxypropanesulfonate degradation
Chen, iScience 2024 - “...HpfG; HpfD (Uniprot: R2XLL6 ), 3-sulfopropionaldehyde reductase; HpfE (Uniprot: R2XKG4 ), 3-HPS exporter; HpfX (Uniprot: R2XKF7 ), 3-sulfopropionaldehyde dehydrogenase; HpfYZ (Uniprot: R2XLL0 , R2XZF8 ), 3-sulfopropionate-CoA ligase; TauE (Uniprot: R2VCQ9 ), probable 3-sulfopropionate exporter; SQ, sulfoquinovose; SQGro, sulfoquinovosyl glycerol; SF, 6-deoxy-6-sulfofructose; SLA, sulfolactaldehyde; DHPS, dihydroxypropanesulfonate; 3-SPA,...”
- “...and purified HpfD ( Eg HpfD, Uniprot: R2XLL6 ) and HpfX ( Eg HpfX, Uniprot: R2XKF7 ) ( FiguresS1 A and S1B). N-terminal His 6 -tagged HpfY ( Eg HpfY, Uniprot: R2XLL0) and untagged HpfZ ( Eg HpfZ, Uniprot: R2XZF8) were co-expressed followed by Ni 2+...”
Ccel_1083 iron-containing alcohol dehydrogenase from Clostridium cellulolyticum H10
41% identity, 46% coverage
Teth514_1935 iron-containing alcohol dehydrogenase from Thermoanaerobacter ethanolicus X514
42% identity, 47% coverage
- Alcohol dehydrogenases AdhE and AdhB with broad substrate ranges are important enzymes for organic acid reduction in Thermoanaerobacter sp. strain X514
Hitschler, Biotechnology for biofuels 2021 - “...X514, Lin et al . (2011) suggested a crucial role for the ADH encoded by Teth514_1935 [ 16 ], while Hemme et al . (2011) suggested that AdhB likely catalyzed the aldehyde reduction [ 17 ]. Due to the lack of tools enabling genetic modification of...”
- “...protein (Teth514_1882) and the remaining six genes as iron-containing ADH (Teth514_0145, Teth514_0241, Teth514_0564, Teth514_0627, Teth514_0654, Teth514_1935). The major aim of our study was to shed light on the role of ADHs in Thermoanaerobacter sp. strain X514, in sugar fermentation to ethanol and in organic acid reduction...”
- Alcohol Selectivity in a Synthetic Thermophilic n-Butanol Pathway Is Driven by Biocatalytic and Thermostability Characteristics of Constituent Enzymes
Loder, Applied and environmental microbiology 2015 - “...enzymes. TTE0544 (crt), TTE0548 (hbd), TTE0549 (thl), Teth514_1935 (X514-bdh), and Teth514_1942 (X514-bad) were amplified by PCR from genomic DNA (gDNA)...”
- “...TTE0548 TTE0544 STHERM_c16300 Cthe_0423 Teth514_0627 Teth514_1942 Teth514_1935 Homology to Enzyme query Sequence- SDS- Purityc MMd Molecular (Cov-ID-Pos)e...”
- Correlation of genomic and physiological traits of thermoanaerobacter species with biofuel yields
Hemme, Applied and environmental microbiology 2011 - “...Teth514_0627 Teth514_0653 Teth514_0654 Teth514_1808 Teth514_1882 Teth514_1935 167038817 167038910 167039223 167039286 167039312 167039313 167040441 167040513...”
Cphy_1416 aldehyde dehydrogenase family protein from Clostridium phytofermentans ISDg
36% identity, 51% coverage
I3E2P9 methanol dehydrogenase (EC 1.1.1.244) from Bacillus methanolicus (see 4 papers)
41% identity, 47% coverage
SQWD_ACHSX / A0A3A6N9T6 Sulfoacetaldehyde dehydrogenase; CoA-acylating sulfoacetaldehyde dehydrogenase; NAD(+)-dependent acylating sulfoacetaldehyde dehydrogenase; EC 1.2.1.- from Acholeplasma sp. (see paper)
38% identity, 50% coverage
- function: Part of a variant of the sulfo-TK pathway, a D-sulfoquinovose degradation pathway that produces sulfoacetate (PubMed:37404184). Catalyzes the oxidation of sulfoacetaldehyde (SA) to sulfoacetyl- coenzyme A (sulfoacetyl-CoA) (PubMed:37404184). Is highly specific for NAD(+), with only residual (1%) activity with NADP(+) (PubMed:37404184). Cannot use acetaldehyde (PubMed:37404184).
catalytic activity: sulfoacetaldehyde + NAD(+) + CoA = sulfoacetyl-CoA + NADH + H(+) (RHEA:76679)
8uhwF / A3DCI2 The structure of the clostridium thermocellum adhe spirosome
46% identity, 40% coverage
- Ligand: fe (iii) ion (8uhwF)
CIBE_4892 1-propanol dehydrogenase PduQ from Clostridium beijerinckii
44% identity, 45% coverage
- l-Rhamnose Metabolism in Clostridium beijerinckii Strain DSM 6423
Diallo, Applied and environmental microbiology 2019 - “...propanol dehydrogenase and a propionaldehyde dehydrogenase, respectively. A homologue for the propanol dehydrogenase is present (CIBE_4892), belonging to the Zn-dependent dehydrogenases. For the propionaldehyde dehydrogenase, 2 homologues are present in the cluster (CIBE_4884 and 4893), which is unlike the case for C. phytofermentans , which contains...”
- “...regulator receiver protein 9.16 8.34 7.15 CIBE_4891 Signal transduction histidine kinase, LytS 9.42 8.49 6.93 CIBE_4892 Propanol dehydrogenase Klebsiella pneumoniae Dhat (43) 9.99 10 7.57 CIBE_4893 Propionaldehyde dehydrogenase C. phytofermentans Cphy_1178 (63) 9.54 9.56 7.27 CIBE_4894 BMC-P shell protein C. phytofermentans Cphy_1184 (71) 9.47 9.43 7.45...”
CPE0449 alcohol dehydrogenase from Clostridium perfringens str. 13
44% identity, 44% coverage
I3E949 methanol dehydrogenase (EC 1.1.1.244) from Bacillus methanolicus (see 2 papers)
41% identity, 47% coverage
I3DVX6 methanol dehydrogenase (EC 1.1.1.244) from Bacillus methanolicus (see paper)
40% identity, 47% coverage
FC61_GL000705 1-propanol dehydrogenase PduQ from Levilactobacillus brevis ATCC 14869 = DSM 20054
38% identity, 47% coverage
Desku_2952 iron-containing alcohol dehydrogenase from Desulfofundulus kuznetsovii DSM 6115
41% identity, 44% coverage
- A Novel View on the Taxonomy of Sulfate-Reducing Bacterium ‘Desulfotomaculum salinum’ and a Description of a New Species Desulfofundulus salinus sp. nov
Nazina, Microorganisms 2024 - “...the methyl transferase system decreased significantly, while the activity of one of the ADHs increased (Desku_2952), together with that of aldehyde ferredoxin oxidoreductase (Desku_2951), which confirmed the possibility of the existence of another pathway for methanol assimilation via the ADH pathway. Methanol is probably oxidized by...”
- “...the sequence of the gene of the tentatively active ADH from D. kuznetsovii 17 T (Desku_2952). This may indicate the possible functioning of a cobalt-independent, NAD-dependent alcohol dehydrogenase (ADH) pathway of methanol oxidation in strain 435 T . Unlike D. kuznetsovii 17 T , in the...”
- Phenotypic and Genomic Characterization of a Sulfate-Reducing Bacterium Pseudodesulfovibrio methanolicus sp. nov. Isolated from a Petroleum Reservoir in Russia
Bidzhieva, Biology 2024 - “...this pathway were alcohol dehydrogenase (ADH) (EC: 1.1.1.1) encoded by one of several ADH-determining genes (Desku_2952), represented in the genome of D. kuznetsovii 17 T , and aldehyde ferredoxin oxidoreductase (1.2.7.5) encoded by aor gene (Desku_02951). In the genome of strain 5S69 T , homologous genes...”
D7024_02725 iron-containing alcohol dehydrogenase from Desulfofundulus salinus
40% identity, 44% coverage
B1HX72 methanol dehydrogenase (EC 1.1.1.244) from Lysinibacillus sphaericus (see paper)
39% identity, 47% coverage
For advice on how to use these tools together, see
Interactive tools for functional annotation of bacterial genomes.
The PaperBLAST database links 793,807 different protein sequences to 1,259,118 scientific articles. Searches against EuropePMC were last performed on March 13 2025.
PaperBLAST builds a database of protein sequences that are linked
to scientific articles. These links come from automated text searches
against the articles in EuropePMC
and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot,
BRENDA,
CAZy (as made available by dbCAN),
BioLiP,
CharProtDB,
MetaCyc,
EcoCyc,
TCDB,
REBASE,
the Fitness Browser,
and a subset of the European Nucleotide Archive with the /experiment tag.
Given this database and a protein sequence query,
PaperBLAST uses protein-protein BLAST
to find similar sequences with E < 0.001.
To build the database, we query EuropePMC with locus tags, with RefSeq protein
identifiers, and with UniProt
accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use
queries of the form "locus_tag AND genus_name" to try to ensure that
the paper is actually discussing that gene. Because EuropePMC indexes
most recent biomedical papers, even if they are not open access, some
of the links may be to papers that you cannot read or that our
computers cannot read. We query each of these identifiers that
appears in the open access part of EuropePMC, as well as every locus
tag that appears in the 500 most-referenced genomes, so that a gene
may appear in the PaperBLAST results even though none of the papers
that mention it are open access. We also incorporate text-mined links
from EuropePMC that link open access articles to UniProt or RefSeq
identifiers. (This yields some additional links because EuropePMC
uses different heuristics for their text mining than we do.)
For every article that mentions a locus tag, a RefSeq protein
identifier, or a UniProt accession, we try to select one or two
snippets of text that refer to the protein. If we cannot get access to
the full text, we try to select a snippet from the abstract, but
unfortunately, unique identifiers such as locus tags are rarely
provided in abstracts.
PaperBLAST also incorporates manually-curated protein functions:
- Proteins from NCBI's RefSeq are included if a
GeneRIF
entry links the gene to an article in
PubMed®.
GeneRIF also provides a short summary of the article's claim about the
protein, which is shown instead of a snippet.
- Proteins from Swiss-Prot (the curated part of UniProt)
are included if the curators
identified experimental evidence for the protein's function (evidence
code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that
describe the protein's function are shown (with bold headings).
- Proteins from BRENDA,
a curated database of enzymes, are included if they are linked to a paper in PubMed
and their full sequence is known.
- Every protein from the non-redundant subset of
BioLiP,
a database
of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself
does not include descriptions of the proteins, those are taken from the
Protein Data Bank.
Descriptions from PDB rely on the original submitter of the
structure and cannot be updated by others, so they may be less reliable.
(For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every
ligand is represented among a group of structures with similar sequences, but for
PaperBLAST, we use the non-redundant set provided by BioLiP.)
- Every protein from EcoCyc, a curated
database of the proteins in Escherichia coli K-12, is included, regardless
of whether they are characterized or not.
- Proteins from the MetaCyc metabolic pathway database
are included if they are linked to a paper in PubMed and their full sequence is known.
- Proteins from the Transport Classification Database (TCDB)
are included if they have known substrate(s), have reference(s),
and are not described as uncharacterized or putative.
(Some of the references are not visible on the PaperBLAST web site.)
- Every protein from CharProtDB,
a database of experimentally characterized protein annotations, is included.
- Proteins from the CAZy database of carbohydrate-active enzymes
are included if they are associated with an Enzyme Classification number.
Even though CAZy does not provide links from individual protein sequences to papers,
these should all be experimentally-characterized proteins.
- Proteins from the REBASE database
of restriction enzymes are included if they have known specificity.
- Every protein with an evidence-based reannotation (based on mutant phenotypes)
in the Fitness Browser is included.
- Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators)
with experimentally-determined DNA binding sites from the
PRODORIC database of gene regulation in prokaryotes.
- Putative transcription factors from RegPrecise
that have manually-curated predictions for their binding sites. These predictions are based on
conserved putative regulatory sites across genomes that contain similar transcription factors,
so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
- Coding sequence (CDS) features from the
European Nucleotide Archive (ENA)
are included if the /experiment tag is set (implying that there is experimental evidence for the annotation),
the nucleotide entry links to paper(s) in PubMed,
and the nucleotide entry is from the STD data class
(implying that these are targeted annotated sequences, not from shotgun sequencing).
Also, to filter out genes whose transcription or translation was detected, but whose function
was not studied, nucleotide entries or papers with more than 25 such proteins are excluded.
Descriptions from ENA rely on the original submitter of the
sequence and cannot be updated by others, so they may be less reliable.
Except for GeneRIF and ENA,
the curated entries include a short curated
description of the protein's function.
For entries from BioLiP, the protein's function may not be known beyond binding to the ligand.
Many of these entries also link to articles in PubMed.
For more information see the
PaperBLAST paper (mSystems 2017)
or the code.
You can download PaperBLAST's database here.
Changes to PaperBLAST since the paper was written:
- November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
- February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
- June 2022: incorporated some coding sequences from ENA with the /experiment tag.
- March 2022: incorporated BioLiP.
- April 2020: incorporated TCDB.
- April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
- February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
- January 2018: incorporated BRENDA.
- December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
- September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.
Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.
PaperBLAST cannot provide snippets for many of the papers that are
published in non-open-access journals. This limitation applies even if
the paper is marked as "free" on the publisher's web site and is
available in PubmedCentral or EuropePMC. If a journal that you publish
in is marked as "secret," please consider publishing elsewhere.
Many important articles are missing from PaperBLAST, either because
the article's full text is not in EuropePMC (as for many older
articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an
article that characterizes a protein's function but is missing from
PaperBLAST, please notify the curators at UniProt
or add an entry to GeneRIF.
Entries in either of these databases will eventually be incorporated
into PaperBLAST. Note that to add an entry to UniProt, you will need
to find the UniProt identifier for the protein. If the protein is not
already in UniProt, you can ask them to create an entry. To add an
entry to GeneRIF, you will need an NCBI Gene identifier, but
unfortunately many prokaryotic proteins in RefSeq do not have
corresponding Gene identifers.
References
PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.
Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.
Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.
UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.
BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.
The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.
The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.
CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.
The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.
The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.
REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.
Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory