Comparing 14148 FitnessBrowser__Keio:14148 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00547 Homoserine kinase; HK; HSK; EC 2.7.1.39 from Escherichia coli (strain K12) (see paper)
100% identity, 100% coverage: 1:310/310 of query aligns to 1:310/310 of P00547
Q8L7R2 Homoserine kinase; Protein DOWNY MILDEW RESISTANT 1; EC 2.7.1.39 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 100% coverage: 2:310/310 of query aligns to 54:367/370 of Q8L7R2
Sites not aligning to the query:
1h74B Crystal structure of homoserine kinase complexed with ile (see paper)
31% identity, 93% coverage: 2:290/310 of query aligns to 3:283/296 of 1h74B
1h74A Crystal structure of homoserine kinase complexed with ile (see paper)
31% identity, 93% coverage: 2:290/310 of query aligns to 3:283/296 of 1h74A
1h73A Crystal structure of homoserine kinase complexed with threonine (see paper)
31% identity, 93% coverage: 2:290/310 of query aligns to 3:283/296 of 1h73A
1h72C Crystal structure of homoserine kinase complexed with hse (see paper)
31% identity, 93% coverage: 2:290/310 of query aligns to 3:283/296 of 1h72C
1fwkA Crystal structure of homoserine kinase complexed with adp (see paper)
31% identity, 93% coverage: 2:290/310 of query aligns to 3:283/296 of 1fwkA
4dxlA Crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abscessus, bound to cmp and atp (see paper)
26% identity, 80% coverage: 32:280/310 of query aligns to 44:279/304 of 4dxlA
Sites not aligning to the query:
3pygA Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with adp
26% identity, 90% coverage: 32:309/310 of query aligns to 37:298/298 of 3pygA
Sites not aligning to the query:
3pyeA Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with cdpme
26% identity, 90% coverage: 32:309/310 of query aligns to 40:301/301 of 3pyeA
Sites not aligning to the query:
3pyfA Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with amp-pnp
26% identity, 89% coverage: 32:308/310 of query aligns to 36:296/296 of 3pyfA
Sites not aligning to the query:
2v8pA Ispe in complex with adp and cdp (see paper)
25% identity, 74% coverage: 56:284/310 of query aligns to 57:262/270 of 2v8pA
Sites not aligning to the query:
2v34B Ispe in complex with cytidine and ligand (see paper)
25% identity, 74% coverage: 56:284/310 of query aligns to 57:262/270 of 2v34B
Sites not aligning to the query:
2v2vA Ispe in complex with ligand (see paper)
25% identity, 74% coverage: 56:284/310 of query aligns to 57:262/270 of 2v2vA
Sites not aligning to the query:
2v2qB Ispe in complex with ligand (see paper)
25% identity, 74% coverage: 56:284/310 of query aligns to 57:262/270 of 2v2qB
Sites not aligning to the query:
2vf3A Aquifex aeolicus ispe in complex with ligand (see paper)
25% identity, 74% coverage: 56:284/310 of query aligns to 56:261/269 of 2vf3A
Sites not aligning to the query:
2v34A Ispe in complex with cytidine and ligand (see paper)
25% identity, 74% coverage: 56:284/310 of query aligns to 56:261/269 of 2v34A
Sites not aligning to the query:
2v2zA Ispe in complex with adp and cdpme (see paper)
25% identity, 74% coverage: 56:284/310 of query aligns to 56:261/269 of 2v2zA
Sites not aligning to the query:
6cyzA Mycobacterial homoserine kinase thrb in complex with amppnp
29% identity, 91% coverage: 3:284/310 of query aligns to 11:280/295 of 6cyzA
6mdeA Mevalonate kinase from methanosarcina mazei with mevalonate bound (see paper)
30% identity, 28% coverage: 74:160/310 of query aligns to 68:157/302 of 6mdeA
Sites not aligning to the query:
>14148 FitnessBrowser__Keio:14148
MVKVYAPASSANMSVGFDVLGAAVTPVDGALLGDVVTVEAAETFSLNNLGRFADKLPSEP
RENIVYQCWERFCQELGKQIPVAMTLEKNMPIGSGLGSSACSVVAALMAMNEHCGKPLND
TRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENDIISQQVPGFDEWLWVLAYPGI
KVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPELAAKLMKDVIAEPYRERLLP
GFRQARQAVAEIGAVASGISGSGPTLFALCDKPETAQRVADWLGKNYLQNQEGFVHICRL
DTAGARVLEN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory