Comparing 14358 FitnessBrowser__Keio:14358 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
24% identity, 81% coverage: 34:241/256 of query aligns to 33:243/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
24% identity, 81% coverage: 34:241/256 of query aligns to 33:243/261 of 3klcA
Sites not aligning to the query:
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
24% identity, 81% coverage: 34:241/256 of query aligns to 34:244/262 of Q9UYV8
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
25% identity, 84% coverage: 34:248/256 of query aligns to 35:262/276 of Q9NQR4
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
23% identity, 79% coverage: 34:235/256 of query aligns to 41:247/269 of 6ypaB
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
23% identity, 79% coverage: 34:235/256 of query aligns to 35:241/263 of 7ovgA
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 61% coverage: 91:245/256 of query aligns to 130:297/307 of Q94JV5
Sites not aligning to the query:
P47016 Deaminated glutathione amidase; dGSH amidase; Nitrilase homolog 1; EC 3.5.1.128 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
30% identity, 58% coverage: 99:247/256 of query aligns to 119:298/307 of P47016
4hg5A Structural insights into yeast nit2: wild-type yeast nit2 in complex with oxaloacetate (see paper)
30% identity, 58% coverage: 99:247/256 of query aligns to 116:295/304 of 4hg5A
Sites not aligning to the query:
4hg3A Structural insights into yeast nit2: wild-type yeast nit2 in complex with alpha-ketoglutarate (see paper)
30% identity, 58% coverage: 99:247/256 of query aligns to 116:295/304 of 4hg3A
Sites not aligning to the query:
4hgdA Structural insights into yeast nit2: c169s mutant of yeast nit2 in complex with an endogenous peptide-like ligand (see paper)
29% identity, 58% coverage: 99:247/256 of query aligns to 115:291/299 of 4hgdA
Sites not aligning to the query:
O25067 Aliphatic amidase; Acylamide amidohydrolase; EC 3.5.1.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
22% identity, 83% coverage: 30:242/256 of query aligns to 47:267/339 of O25067
5h8jB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine (see paper)
19% identity, 84% coverage: 34:249/256 of query aligns to 36:278/297 of 5h8jB
5h8iC Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine (see paper)
19% identity, 84% coverage: 34:249/256 of query aligns to 40:282/301 of 5h8iC
4iztA The e41q mutant of the amidase from nesterenkonia sp. An1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine
27% identity, 48% coverage: 97:218/256 of query aligns to 110:232/263 of 4iztA
4izuA The e41q mutant of the amidase from nesterenkonia sp. An1 showing the result of michael addition of acrylamide at the active site cysteine
27% identity, 51% coverage: 86:215/256 of query aligns to 91:221/254 of 4izuA
Sites not aligning to the query:
>14358 FitnessBrowser__Keio:14358
MPGLKITLLQQPLVWMDGPANLRHFDRQLEGITGRDVIVLPEMFTSGFAMEAAASSLAQD
DVVNWMTAKAQQCNALIAGSVALQTESGSVNRFLLVEPGGTVHFYDKRHLFRMADEHLHY
KAGNARVIVEWRGWRILPLVCYDLRFPVWSRNLNDYDLALYVANWPAPRSLHWQALLTAR
AIENQAYVAGCNRVGSDGNGCHYRGDSRVINPQGEIIATADAHQATRIDAELSMAALREY
REKFPAWQDADEFRLW
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory