SitesBLAST
Comparing 14408 FitnessBrowser__Keio:14408 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
P02921 Melibiose permease; Melibiose carrier; Melibiose transporter; Melibiose/cation symporter; Na+ (Li+)/melibiose symporter; Thiomethylgalactoside permease II from Escherichia coli (strain K12) (see 5 papers)
28% identity, 98% coverage: 3:451/460 of query aligns to 2:459/473 of P02921
- K18 (vs. gap) mutation to C: Abolishes transporter activity.
- D19 (= D16) mutation to C: Abolishes transporter activity. Can bind Na(+). Large decrease in the affinity for melibiose in the presence of H(+).
- D35 (= D36) mutation to C: Abolishes transporter activity.
- R52 (= R53) mutation to C: Abolishes transporter activity.
- D55 (= D56) mutation to C: Abolishes transporter activity. Chemical restoration of the charge via the oxidation of the thiol to the sulfinic and/or sulfonic acid results in partial recovery of transporter activity. Does not bind Na(+). Binds melibiose in the presence of H(+).
- D59 (= D60) mutation to C: Loses ability to catalyze Na(+) or H(+)-coupled melibiose transport against a concentration gradient. Does not bind Na(+). Binds melibiose in the presence of H(+).
- D124 (≠ N125) mutation to C: Abolishes transporter activity. Chemical restoration of the charge via the oxidation of the thiol to the sulfinic and/or sulfonic acid results in partial recovery of transporter activity. Can bind Na(+), but structural changes induced by Na(+) are less complete and of smaller amplitude. Large decrease in the affinity for melibiose in the presence of H(+).
- K138 (≠ P139) mutation to C: Can transport melibiose.
- R139 (≠ K140) mutation to C: Can transport melibiose.
- R141 (= R142) mutation R->C,Q: Abolishes melibiose transport. Decreases affinity for melibiose.; mutation to K: Retains ion-coupled melibiose transport.
- R149 (≠ F150) mutation to C: Abolishes melibiose transport.; mutation R->K,Q: Retains ion-coupled melibiose transport.
- R199 (≠ F200) mutation to C: Does not affect transporter activity.
- E203 (= E204) mutation to C: Does not affect transporter activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P30878 Melibiose permease; Melibiose carrier; Melibiose transporter; Melibiose/cation symporter; Na+ (Li+)/melibiose symporter; Thiomethylgalactoside permease II from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
27% identity, 96% coverage: 3:444/460 of query aligns to 2:452/476 of P30878
- K18 (vs. gap) mutation to C: Loss of transporter activity.
- KD 18:19 (≠ -D 16) binding
- D19 (= D16) mutation to C: Loss of transporter activity.
- R52 (= R53) mutation to C: Retains weak activity with Na(+), Li(+) or H(+).
- D55 (= D56) mutation to C: Alters cation selectivity. Retains a low level of H(+)-coupled melibiose transport, but retains only a weak activity with Na(+) or Li(+).
- N58 (≠ T59) mutation to C: Alters cation selectivity. Decreases H(+)- and Na(+)-coupled activity, with little effect on Li(+)-coupled melibiose transport.
- D59 (= D60) mutation to C: Alters cation selectivity. Retains only a low level of H(+)-coupled melibiose binding and active transport, but Na(+) or Li(+) does not stimulate either binding or transport.
- Y120 (= Y121) mutation to C: Loss of transporter activity.
- T121 (= T122) mutation to C: Alters cation selectivity. Inhibits H(+)- and Na(+)-coupled activity, with little effect on Li(+)-coupled melibiose transport.
- M123 (≠ V124) mutation to C: Does not affect transporter activity.
- D124 (≠ N125) binding ; mutation to C: Alters cation selectivity. Loss of transporter activity.
- W128 (≠ C129) binding ; mutation to C: Loss of transporter activity.
- R149 (≠ F150) binding ; mutation to C: Retains weak activity with Na(+), Li(+) or H(+).
- K377 (= K370) mutation to C: Inhibits Na(+)- and Li(+)-coupled activity, with little effect on H(+)-coupled melibiose transport.
7l17A Crystal structure of sugar-bound melibiose permease melb (see paper)
27% identity, 96% coverage: 3:444/460 of query aligns to 1:451/453 of 7l17A
7l16A Crystal structure of sugar-bound melibiose permease melb (see paper)
27% identity, 96% coverage: 3:444/460 of query aligns to 1:451/453 of 7l16A
A6NFX1 Sphingosine-1-phosphate transporter MFSD2B; Major facilitator superfamily domain-containing protein 2B; hMfsd2b from Homo sapiens (Human) (see paper)
25% identity, 97% coverage: 3:446/460 of query aligns to 38:500/504 of A6NFX1
- D95 (= D60) mutation to A: Abolishes export of sphingosine-1-phosphate.
- T157 (= T122) mutation to A: Abolishes export of sphingosine-1-phosphate.
- K423 (= K370) mutation to A: Does not affect export of sphingosine-1-phosphate.
Q9DA75 Sodium-dependent lysophosphatidylcholine symporter 1; NLS1; Sodium-dependent LPC symporter 1; Major facilitator superfamily domain-containing protein 2A; Mfsd2a from Mus musculus (Mouse) (see 2 papers)
22% identity, 99% coverage: 3:459/460 of query aligns to 39:532/534 of Q9DA75
- Y55 (≠ C19) mutation to A: Significant reduction in LPC transport.
- Q56 (≠ G20) mutation to A: Slightly reduced LPC transport.
- F64 (= F28) mutation to A: Slightly increased LPC transport.
- Q67 (≠ A31) mutation to H: Abolishes LPC transport.
- S82 (≠ G46) mutation to A: No effect on LPC transport.
- F86 (≠ L50) mutation to A: Slightly reduced LPC transport.
- R89 (= R53) mutation to A: No effect on LPC transport.
- D92 (= D56) mutation to A: Significant reduction in LPC transport. Abolishes LPC transport; when associated with A-96.
- T95 (= T59) mutation to A: Significant reduction in LPC transport.
- D96 (= D60) mutation to A: Abolishes LPC transport. Abolishes LPC transport; when associated with A-92.
- E159 (≠ L117) mutation to A: Slightly reduced LPC transport.
- T163 (≠ Y121) mutation to A: Slightly reduced LPC transport.; mutation to M: Abolishes LPC transport.
- H166 (≠ N125) mutation to A: Abolishes LPC transport.
- P168 (= P127) mutation to T: Significant reduction in LPC transport.
- S170 (≠ C129) mutation to L: Significant reduction in LPC transport.
- R190 (= R149) mutation to A: Abolishes LPC transport.
- E194 (≠ A153) mutation to A: Significant reduction in LPC transport.
- T202 (vs. gap) mutation to A: Slightly increased LPC transport.; mutation to F: Significant reduction in LPC transport.; mutation to M: Significant reduction in LPC transport.
- Q207 (vs. gap) mutation to A: Slightly reduced LPC transport.
- C216 (vs. gap) modified: Disulfide link with 464; mutation to A: Significant reduction in LPC transport.
- A254 (≠ G188) mutation to F: Abolishes LPC transport.
- F305 (= F235) mutation to A: Significant reduction in LPC transport.
- S309 (≠ A239) mutation to A: Significant reduction in LPC transport.
- R330 (≠ P261) mutation to H: No effect on LPC transport.
- Q334 (≠ T265) mutation to A: Slightly reduced LPC transport.
- N335 (≠ Q266) mutation to A: Significant reduction in LPC transport.
- S343 (≠ A274) mutation to L: Significant reduction in LPC transport.
- F403 (≠ T335) mutation to A: Significant reduction in LPC transport.
- P406 (≠ Q338) mutation to H: Significant reduction in LPC transport.
- W407 (= W339) mutation to A: Significant reduction in LPC transport.
- T439 (≠ L369) mutation to A: No effect on LPC transport.
- K440 (= K370) mutation to A: Abolishes LPC transport.
- T451 (≠ G381) mutation to A: Slightly reduced LPC transport.
- D455 (≠ A385) mutation to A: Slightly reduced LPC transport.
- R461 (≠ A391) mutation to A: Slightly reduced LPC transport.
- C464 (≠ S394) modified: Disulfide link with 216; mutation to A: Significant reduction in LPC transport.
- P497 (≠ K427) mutation to L: Abolishes LPC transport.
8d2sA Zebrafish mfsd2a isoform b in inward open ligand bound conformation (see paper)
23% identity, 96% coverage: 2:444/460 of query aligns to 1:475/475 of 8d2sA
- binding [(2~{R})-2-oxidanyl-3-[oxidanyl-[2-(trimethyl-$l^{4}-azanyl)ethoxy]phosphoryl]oxy-propyl] (9~{Z},12~{Z},15~{Z})-octadeca-9,12,15-trienoate: R52 (= R53), D55 (= D56), D142 (≠ H143), R148 (= R149), M149 (≠ F150), T150 (≠ F151), E152 (≠ A153), V153 (≠ A154), T156 (≠ S157), L157 (= L158), F280 (≠ A249), M302 (≠ L268), A305 (≠ G271), T306 (≠ S272), T306 (≠ S272), L307 (= L273), I309 (≠ T275), A356 (≠ T333), F364 (vs. gap), W368 (= W339), W368 (= W339), E389 (≠ D358), E389 (≠ D358), Y393 (≠ F362), Y393 (≠ F362), T400 (≠ L369), K401 (= K370)
F1NCD6 Sodium-dependent lysophosphatidylcholine symporter 1; NLS1; Sodium-dependent LPC symporter 1; Major facilitator superfamily domain-containing protein 2A; GgMFSD2A from Gallus gallus (Chicken) (see paper)
22% identity, 96% coverage: 4:444/460 of query aligns to 36:510/528 of F1NCD6
- C207 (vs. gap) modified: Disulfide link with 460
- N218 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N227 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- C460 (≠ S394) modified: Disulfide link with 207
Q8NA29 Sodium-dependent lysophosphatidylcholine symporter 1; NLS1; Sodium-dependent LPC symporter 1; Major facilitator superfamily domain-containing protein 2A; HsMFSD2A; MFSD2a from Homo sapiens (Human) (see 6 papers)
21% identity, 99% coverage: 3:459/460 of query aligns to 40:541/543 of Q8NA29
- Q57 (vs. gap) mutation to E: Does not affect lysophosphatidylcholine (LPC) transport.; mutation to L: Abolished lysophosphatidylcholine (LPC) transport.
- F65 (≠ W23) mutation to A: Abolished lysophosphatidylcholine (LPC) transport.
- F66 (≠ Q24) mutation to A: Abolished lysophosphatidylcholine (LPC) transport.
- D73 (≠ A31) mutation to A: Abolished lysophosphatidylcholine (LPC) transport.
- V81 (vs. gap) natural variant: Missing (in NEDMISBA; uncertain significance; dbSNP:rs1570238098)
- R103 (= R53) mutation R->A,K,E: Reduced lysophosphatidylcholine (LPC) transport.; mutation to A: No effect on cell sensitivity toward tunicamycin.
- D106 (= D56) mutation to A: No effect on cell sensitivity toward tunicamycin.
- D110 (= D60) mutation to A: Drastic loss of cell sensitivity toward tunicamycin. Abolished lysophosphatidylcholine (LPC) transport.
- T172 (= T122) to M: in NEDMISBA; no effect on cell membrane localization; loss of LPC transport activity; dbSNP:rs1057517688
- P177 (= P127) mutation to T: Reduced expression; no effect on cell membrane localization; decreased LPC transport activity.
- S179 (≠ C129) to L: in NEDMISBA; no effect on cell membrane localization; decreased LPC transport activity; dbSNP:rs1057517689
- M200 (≠ F150) mutation to F: Reduced lysophosphatidylcholine (LPC) transport.
- T211 (vs. gap) to M: in NEDMISBA; reduced expression; no effect on cell membrane localization; decreased LPC transport activity; dbSNP:rs756467073
- C225 (vs. gap) mutation to A: Reduced lysophosphatidylcholine (LPC) transport.
- N230 (vs. gap) mutation to Q: Loss of glycosylation; when associated with Q-240.
- N240 (vs. gap) mutation to Q: Loss of glycosylation; when associated with Q-230.
- V263 (≠ M184) to F: in NEDMISBA; reduced expression; no effect on cell membrane localization; decreased LPC transport activity
- E325 (≠ R246) mutation E->A,D,Q,R: Abolished lysophosphatidylcholine (LPC) transport.
- F328 (≠ A249) mutation F->A,Y: Reduced lysophosphatidylcholine (LPC) transport.
- Y334 (= Y256) mutation to A: Does not affect lysophosphatidylcholine (LPC) transport.
- R339 (≠ P261) to H: in NEDMISBA; reduced expression; no effect on cell membrane localization; no effect on LPC transport activity; dbSNP:rs776741331; mutation to A: Reduced lysophosphatidylcholine (LPC) transport.
- F342 (≠ A264) mutation to A: Abolished lysophosphatidylcholine (LPC) transport.
- L346 (= L268) mutation to A: Abolished lysophosphatidylcholine (LPC) transport.
- I349 (≠ G271) mutation to A: Reduced lysophosphatidylcholine (LPC) transport.
- M350 (≠ S272) mutation to A: Reduced lysophosphatidylcholine (LPC) transport.
- S352 (≠ A274) to L: in NEDMISBA; no effect on cell membrane localization; decreased LPC transport activity; dbSNP:rs1057519087
- I357 (≠ S279) mutation to A: Does not affect lysophosphatidylcholine (LPC) transport.; mutation to W: Abolished lysophosphatidylcholine (LPC) transport.
- Q361 (≠ S283) mutation to W: Reduced lysophosphatidylcholine (LPC) transport.
- A404 (≠ F327) mutation to W: Abolished lysophosphatidylcholine (LPC) transport.
- F412 (≠ T335) mutation F->I,W: Reduced lysophosphatidylcholine (LPC) transport.
- W416 (= W339) mutation W->A,F: Reduced lysophosphatidylcholine (LPC) transport.
- K449 (= K370) mutation K->A,R,Q: Reduced lysophosphatidylcholine (LPC) transport.; mutation to A: Loss of plasma membrane localization. Loss of cell sensitivity toward tunicamycin.
- Y468 (= Y389) mutation to A: Abolished lysophosphatidylcholine (LPC) transport.
- C473 (≠ S394) mutation to A: Reduced lysophosphatidylcholine (LPC) transport.
- P506 (≠ K427) to L: in NEDMISBA; reduced expression; no effect on cell membrane localization; loss of LPC transport activity
Q3T9M1 Sphingosine-1-phosphate transporter MFSD2B; Major facilitator superfamily domain-containing protein 2B; mMfsd2b from Mus musculus (Mouse) (see 2 papers)
28% identity, 34% coverage: 3:158/460 of query aligns to 28:183/494 of Q3T9M1
- D85 (= D60) mutation to A: Decreased sphingosine-1-phosphate transport.
- T147 (= T122) mutation to A: Decreased export of sphingosine-1-phosphate.
Sites not aligning to the query:
- 413 K→A: Decreased sphingosine-1-phosphate transport.
7mjsX Single-particle cryo-em structure of major facilitator superfamily domain containing 2a in complex with lpc-18:3 (see paper)
27% identity, 37% coverage: 4:174/460 of query aligns to 1:168/458 of 7mjsX
Sites not aligning to the query:
Query Sequence
>14408 FitnessBrowser__Keio:14408
MTQLTMKDKIGYGLGDTACGFVWQATMFLLAYFYTDVFGLSAGIMGTLFLVSRVLDAVTD
PLMGLLVDRTRTRHGQFRPFLLWGAIPFGIVCVLTFYTPDFSAQGKIIYACVTYILLTLV
YTFVNVPYCAMPGVITADPKERHALQSWRFFLAAAGSLAISGIALPLVSIIGKGDEQVGY
FGAMCVLGLSGVVLLYVCFFTTKERYTFEVQPGSSVAKDLKLLLGNSQWRIMCAFKMMAT
CSNVVRGGATLYFVKYVMDHPELATQFLLYGSLATMFGSLCSSRLLGRFDRVTAFKWIIV
AYSLISLLIFVTPAEHIALIFALNILFLFVFNTTTPLQWLMASDVVDYEESRSGRRLDGL
VFSTYLFSLKIGLAIGGAVVGWILAYVNYSASSSVQPVEVLTTIKILFCVVPVVLYAGMF
IMLSLYKLTDARVEAISRQLIKHRAAQGEAVPDAATAASH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory