SitesBLAST
Comparing 14732 FitnessBrowser__Keio:14732 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8sbzA Crystal structure of 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase from klebsiella aerogenes (NAD bound, no sulfate hexagonal form)
88% identity, 100% coverage: 1:248/248 of query aligns to 1:245/245 of 8sbzA
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), K15 (= K15), G16 (= G16), I17 (= I17), D36 (= D36), L37 (≠ Q37), L51 (≠ M51), D52 (= D52), V53 (= V53), A79 (= A79), G81 (= G81), I82 (= I82), S131 (= S131), Y144 (= Y144), K148 (= K148), G175 (= G175), S176 (= S176), T177 (= T177), T179 (= T179), M181 (= M181)
8u9aA Crystal structure of 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase from klebsiella aerogenes (dbh bound)
78% identity, 100% coverage: 1:248/248 of query aligns to 2:220/220 of 8u9aA
- binding 2,3-dihydroxy-benzoic acid: L2 (≠ M1), G176 (= G175), P180 (= P208), L181 (= L209), G182 (= G210), K183 (= K211), I184 (= I212), A185 (= A213), N192 (= N220), F196 (= F224), D213 (= D241), G214 (= G242)
Sites not aligning to the query:
8sbvB Crystal structure of 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase from klebsiella aerogenes (adp bound)
75% identity, 100% coverage: 1:248/248 of query aligns to 1:212/212 of 8sbvB
- binding adenosine-5'-diphosphate: G12 (= G12), K15 (= K15), G16 (= G16), I17 (= I17), D36 (= D36), L37 (≠ Q37), L51 (≠ M51), D52 (= D52), V53 (= V53), I82 (= I82), V102 (= V102)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
35% identity, 98% coverage: 1:243/248 of query aligns to 1:240/244 of 6t77A
- active site: G16 (= G16), S138 (= S131), Y151 (= Y144)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ G14), R15 (≠ K15), T37 (≠ Q37), L58 (≠ M51), N59 (≠ D52), V60 (= V53), A87 (= A80), G88 (= G81), I89 (= I82)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 98% coverage: 1:243/248 of query aligns to 1:240/244 of P0AEK2
- GASR 12:15 (≠ GAGK 12:15) binding
- T37 (≠ Q37) binding
- NV 59:60 (≠ DV 52:53) binding
- N86 (≠ A79) binding
- Y151 (= Y144) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YGASK 144:148) binding
- A154 (≠ S147) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K148) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ T177) binding
- E233 (≠ Q236) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
36% identity, 98% coverage: 1:243/248 of query aligns to 1:240/244 of P0A2C9
- M125 (≠ F118) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A226) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S227) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
36% identity, 98% coverage: 2:243/248 of query aligns to 1:239/243 of 1q7bA
- active site: G15 (= G16), E101 (≠ D95), S137 (= S131), Q147 (≠ M141), Y150 (= Y144), K154 (= K148)
- binding calcium ion: E232 (≠ Q236), T233 (≠ D237)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G12), S13 (≠ G14), R14 (≠ K15), T36 (≠ Q37), N58 (≠ D52), V59 (= V53), N85 (≠ A79), A86 (= A80), G87 (= G81), I88 (= I82), S137 (= S131), Y150 (= Y144), K154 (= K148), P180 (= P174), G181 (= G175), I183 (≠ T177)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
36% identity, 98% coverage: 2:243/248 of query aligns to 1:239/243 of 1q7cA
- active site: G15 (= G16), S137 (= S131), Q147 (≠ M141), F150 (≠ Y144), K154 (= K148)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G12), S13 (≠ G14), R14 (≠ K15), A35 (≠ D36), T36 (≠ Q37), L57 (≠ M51), N58 (≠ D52), V59 (= V53), G87 (= G81), I88 (= I82)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
34% identity, 96% coverage: 6:243/248 of query aligns to 5:243/246 of 3osuA
D4A1J4 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Rattus norvegicus (Rat) (see paper)
33% identity, 98% coverage: 3:246/248 of query aligns to 4:245/245 of D4A1J4
- Y147 (= Y144) mutation to F: Loss of function.
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
34% identity, 96% coverage: 6:243/248 of query aligns to 2:236/239 of 3sj7A
- active site: G12 (= G16), S138 (= S131), Q148 (≠ M141), Y151 (= Y144), K155 (= K148)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G12), S10 (≠ G14), R11 (≠ K15), I13 (= I17), N31 (≠ D36), Y32 (≠ Q37), A33 (= A38), G34 (≠ F39), S35 (≠ T40), A58 (vs. gap), N59 (≠ D52), V60 (= V53), N86 (≠ A79), A87 (= A80), T109 (≠ V102), S138 (= S131), Y151 (= Y144), K155 (= K148), P181 (= P174), G182 (= G175)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
33% identity, 98% coverage: 3:246/248 of query aligns to 3:239/239 of 4nbtA
- active site: G16 (= G16), S132 (= S131), Y145 (= Y144), K149 (= K148)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), K15 (= K15), G16 (= G16), L17 (≠ I17), D36 (= D36), L37 (≠ Q37), L52 (≠ M51), N53 (≠ D52), V54 (= V53), N80 (≠ A79), A81 (= A80), G82 (= G81), I130 (≠ V129), S132 (= S131), Y145 (= Y144), K149 (= K148), P177 (= P174), G178 (= G175), I180 (≠ T177), T182 (= T179)
Q8JZV9 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Mus musculus (Mouse) (see paper)
31% identity, 98% coverage: 3:246/248 of query aligns to 4:245/245 of Q8JZV9
- Y147 (= Y144) active site, Proton acceptor; mutation to F: Loss of function.
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
34% identity, 97% coverage: 3:243/248 of query aligns to 2:239/243 of 7emgB
1xhlB Crystal structure of putative tropinone reductase-ii from caenorhabditis elegans with cofactor and substrate
35% identity, 98% coverage: 3:246/248 of query aligns to 2:260/274 of 1xhlB
- active site: G15 (= G16), F24 (= F25), Q30 (≠ K31), N90 (= N78), S144 (= S131), Q150 (≠ A133), Y155 (≠ M141), Y158 (= Y144), K162 (= K148), E203 (≠ D189)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G12), S13 (≠ G14), G15 (= G16), I16 (= I17), R36 (≠ F35), N37 (≠ D36), R40 (≠ F39), D64 (= D52), V65 (= V53), N91 (≠ A79), G93 (= G81), L116 (≠ V102), S144 (= S131), Y158 (= Y144), K162 (= K148), P188 (= P174), G189 (= G175), A190 (≠ S176), V191 (≠ T177), T193 (= T179), G194 (≠ D180), F195 (≠ M181)
- binding 8-methyl-8-azabicyclo[3,2,1]octan-3-one: A190 (≠ S176), F195 (≠ M181)
1xhlA Crystal structure of putative tropinone reductase-ii from caenorhabditis elegans with cofactor and substrate
35% identity, 98% coverage: 3:246/248 of query aligns to 2:260/274 of 1xhlA
- active site: G15 (= G16), F24 (= F25), Q30 (≠ K31), N90 (= N78), S144 (= S131), Q150 (≠ A133), Y155 (≠ M141), Y158 (= Y144), K162 (= K148), E203 (≠ D189)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G12), S13 (≠ G14), G15 (= G16), I16 (= I17), R36 (≠ F35), N37 (≠ D36), R40 (≠ F39), D64 (= D52), V65 (= V53), N91 (≠ A79), A92 (= A80), G93 (= G81), L116 (≠ V102), S144 (= S131), K162 (= K148), P188 (= P174), G189 (= G175), V191 (≠ T177), T193 (= T179), G194 (≠ D180), F195 (≠ M181)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
33% identity, 96% coverage: 6:243/248 of query aligns to 6:250/256 of 7do7A
- active site: G16 (= G16), S146 (= S131), Y159 (= Y144)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), R15 (≠ K15), G16 (= G16), I17 (= I17), S37 (≠ T33), D66 (= D55), A67 (= A56), N93 (≠ A79), A94 (= A80), G95 (= G81), I96 (= I82), V144 (= V129), S145 (≠ A130), S146 (= S131), Y159 (= Y144), K163 (= K148), P189 (= P174), G190 (= G175), I192 (≠ T177), T194 (= T179), I196 (≠ M181)
- binding beta-L-rhamnopyranose: F99 (≠ M85), S146 (= S131), S148 (≠ A133), Q156 (≠ M141), Y159 (= Y144), N197 (≠ Q182), D235 (= D228), M236 (≠ L229), R238 (≠ S231)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
33% identity, 96% coverage: 6:243/248 of query aligns to 6:250/256 of 7b81A
- active site: G16 (= G16), S146 (= S131), Y159 (= Y144)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), S14 (≠ G14), R15 (≠ K15), I17 (= I17), D66 (= D55), A67 (= A56), N93 (≠ A79), A94 (= A80), G95 (= G81), I96 (= I82), T116 (≠ V102), V144 (= V129), S146 (= S131), Y159 (= Y144), K163 (= K148), P189 (= P174), G190 (= G175), I192 (≠ T177), T194 (= T179), I196 (≠ M181)
2ag5A Crystal structure of human dhrs6 (see paper)
33% identity, 99% coverage: 3:247/248 of query aligns to 4:246/246 of 2ag5A
- active site: S133 (= S131), Y147 (= Y144), K151 (= K148), R192 (≠ S188)
- binding nicotinamide-adenine-dinucleotide: Q16 (≠ K15), G17 (= G16), I18 (= I17), D37 (≠ G34), I38 (≠ F35), D58 (= D52), V59 (= V53), V81 (≠ A79), G83 (= G81), L104 (≠ V102), Y147 (= Y144), K151 (= K148), P177 (= P174), V180 (≠ T177), T182 (= T179), S184 (≠ D180)
- binding sulfate ion: R144 (≠ M141), R188 (≠ T184), F202 (≠ G198), R205 (≠ E201)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
32% identity, 99% coverage: 1:246/248 of query aligns to 1:245/248 of Q9KJF1
- M1 (= M1) modified: Initiator methionine, Removed
- S15 (≠ K15) binding
- D36 (= D36) binding
- D62 (= D52) binding
- I63 (≠ V53) binding
- N89 (≠ A79) binding
- Y153 (= Y144) binding
- K157 (= K148) binding
Query Sequence
>14732 FitnessBrowser__Keio:14732
MDFSGKNVWVTGAGKGIGYATALAFVEAGAKVTGFDQAFTQEQYPFATEVMDVADAAQVA
QVCQRLLAETERLDALVNAAGILRMGATDQLSKEDWQQTFAVNVGGAFNLFQQTMNQFRR
QRGGAIVTVASDAAHTPRIGMSAYGASKAALKSLALSVGLELAGSGVRCNVVSPGSTDTD
MQRTLWVSDDAEEQRIRGFGEQFKLGIPLGKIARPQEIANTILFLASDLASHITLQDIVV
DGGSTLGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory