Comparing 14962 FitnessBrowser__Keio:14962 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
P75804 Aldose sugar dehydrogenase YliI; Asd; Soluble aldose sugar dehydrogenase YliI; EC 1.1.5.- from Escherichia coli (strain K12) (see paper)
100% identity, 100% coverage: 1:371/371 of query aligns to 1:371/371 of P75804
2g8sA Crystal structure of the soluble aldose sugar dehydrogenase (asd) from escherichia coli in the apo-form (see paper)
100% identity, 94% coverage: 23:370/371 of query aligns to 1:348/348 of 2g8sA
7cdyA Crystal structure of glucose dehydrogenase
67% identity, 92% coverage: 26:367/371 of query aligns to 2:343/346 of 7cdyA
7cgzA Glucose dehydrogenase
61% identity, 92% coverage: 26:367/371 of query aligns to 2:318/321 of 7cgzA
2ismB Crystal structure of the putative oxidoreductase (glucose dehydrogenase) (ttha0570) from thermus theromophilus hb8
34% identity, 91% coverage: 25:363/371 of query aligns to 2:319/333 of 2ismB
3a9hA Crystal structure of pqq-dependent sugar dehydrogenase holo-form (see paper)
35% identity, 91% coverage: 28:363/371 of query aligns to 8:320/338 of 3a9hA
3a9gA Crystal structure of pqq-dependent sugar dehydrogenase apo-form (see paper)
35% identity, 91% coverage: 28:363/371 of query aligns to 8:320/338 of 3a9gA
3dasA Structure of the pqq-bound form of aldose sugar dehydrogenase (adh) from streptomyces coelicolor
31% identity, 74% coverage: 20:293/371 of query aligns to 1:267/334 of 3dasA
Sites not aligning to the query:
1cq1A Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqqh2 and glucose (see paper)
31% identity, 68% coverage: 12:265/371 of query aligns to 2:266/444 of 1cq1A
Sites not aligning to the query:
1c9uA Crystal structure of the soluble quinoprotein glucose dehydrogenase in complex with pqq (see paper)
31% identity, 68% coverage: 12:265/371 of query aligns to 2:266/444 of 1c9uA
Sites not aligning to the query:
1cruA Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqq and methylhydrazine (see paper)
31% identity, 68% coverage: 12:265/371 of query aligns to 2:270/448 of 1cruA
Sites not aligning to the query:
5minB Apo form of the soluble pqq-dependent glucose dehydrogenase from acinetobacter calcoaceticus
31% identity, 68% coverage: 12:265/371 of query aligns to 2:272/453 of 5minB
Sites not aligning to the query:
P13650 Quinoprotein glucose dehydrogenase B; Glucose dehydrogenase B [pyrroloquinoline-quinone]; Soluble glucose dehydrogenase; s-GDH; EC 1.1.5.2 from Acinetobacter calcoaceticus (see paper)
31% identity, 70% coverage: 5:265/371 of query aligns to 22:296/478 of P13650
Sites not aligning to the query:
7pgmB Hhip-c in complex with heparin (see paper)
27% identity, 39% coverage: 84:226/371 of query aligns to 70:217/427 of 7pgmB
Sites not aligning to the query:
7pgnB Hhp-c in complex with glycosaminoglycan mimic sos (see paper)
26% identity, 45% coverage: 84:250/371 of query aligns to 70:242/438 of 7pgnB
Sites not aligning to the query:
7pgnA Hhp-c in complex with glycosaminoglycan mimic sos (see paper)
26% identity, 37% coverage: 84:222/371 of query aligns to 71:219/437 of 7pgnA
Sites not aligning to the query:
2wfxB Crystal structure of the complex between human hedgehog-interacting protein hip and sonic hedgehog in the presence of calcium (see paper)
25% identity, 43% coverage: 72:231/371 of query aligns to 60:222/417 of 2wfxB
Sites not aligning to the query:
Q96QV1 Hedgehog-interacting protein; HHIP; HIP from Homo sapiens (Human) (see 3 papers)
25% identity, 40% coverage: 84:231/371 of query aligns to 283:447/700 of Q96QV1
>14962 FitnessBrowser__Keio:14962
MHRQSFFLVPLICLSSALWAAPATVNVEVLQDKLDHPWALAFLPDNHGMLITLRGGELRH
WQAGKGLSAPLSGVPDVWAHGQGGLLDVVLAPDFAQSRRIWLSYSEVGDDGKAGTAVGYG
RLSDDLSKVTDFRTVFRQMPKLSTGNHFGGRLVFDGKGYLFIALGENNQRPTAQDLDKLQ
GKLVRLTDQGEIPDDNPFIKESGARAEIWSYGIRNPQGMAMNPWSNALWLNEHGPRGGDE
INIPQKGKNYGWPLATWGINYSGFKIPEAKGEIVAGTEQPVFYWKDSPAVSGMAFYNSDK
FPQWQQKLFIGALKDKDVIVMSVNGDKVTEDGRILTDRGQRIRDVRTGPDGYLYVLTDES
SGELLKVSPRN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory