Comparing 15363 FitnessBrowser__Keio:15363 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3tcfA Crystal structure of e. Coli oppa complexed with endogenous ligands (see paper)
100% identity, 95% coverage: 27:543/543 of query aligns to 1:517/517 of 3tcfA
2rkmA Structure of oppa complexed with lys-lys (see paper)
86% identity, 95% coverage: 27:543/543 of query aligns to 1:517/517 of 2rkmA
1olcA Oligo-peptide binding protein (oppa) complexed with lys-lys- lys-ala (see paper)
86% identity, 95% coverage: 27:543/543 of query aligns to 1:517/517 of 1olcA
1b05A Structure of oligo-peptide binding protein complexed with lys-cys-lys (see paper)
86% identity, 95% coverage: 27:543/543 of query aligns to 1:517/517 of 1b05A
2z23A Crystal structure of y.Pestis oligo peptide binding protein oppa with tri-lysine ligand (see paper)
78% identity, 95% coverage: 27:543/543 of query aligns to 1:517/517 of 2z23A
6dtgA Crystal structure of haemophilus influenzae oppa complex with ylgangrgggs (see paper)
54% identity, 95% coverage: 29:543/543 of query aligns to 4:522/522 of 6dtgA
3o9pA The structure of the escherichia coli murein tripeptide binding protein mppa (see paper)
49% identity, 94% coverage: 35:543/543 of query aligns to 3:509/509 of 3o9pA
3zs6A The structural characterization of burkholderia pseudomallei oppa. (see paper)
43% identity, 94% coverage: 35:542/543 of query aligns to 1:506/506 of 3zs6A
4gl8A X-ray crystal structure of a periplasmic oligopeptide-binding protein/oligopeptide abc transporter(oppaiv) from borrelia burgdorferi
35% identity, 83% coverage: 44:496/543 of query aligns to 7:454/500 of 4gl8A
P24141 Oligopeptide-binding protein OppA; Stage 0 sporulation protein KA from Bacillus subtilis (strain 168) (see paper)
34% identity, 88% coverage: 38:513/543 of query aligns to 39:518/545 of P24141
8arnA Crystal structure of the peptide binding protein, oppa, from bacillus subtilis in complex with an endogenous tetrapeptide (see paper)
34% identity, 88% coverage: 38:513/543 of query aligns to 3:482/509 of 8arnA
8ay0B Crystal structure of the peptide binding protein dppe from bacillus subtilis in complex with murein tripeptide (see paper)
32% identity, 90% coverage: 38:523/543 of query aligns to 1:479/496 of 8ay0B
6npoA Crystal structure of oligopeptide abc transporter from bacillus anthracis str. Ames (substrate-binding domain)
31% identity, 90% coverage: 35:523/543 of query aligns to 3:499/518 of 6npoA
5kztB Listeria monocytogenes oppa bound to peptide
31% identity, 93% coverage: 38:542/543 of query aligns to 4:509/510 of 5kztB
4fajA Structure and mode of peptide binding of pheromone receptor prgz (see paper)
28% identity, 88% coverage: 46:521/543 of query aligns to 10:486/507 of 4fajA
6ofqA Abc transporter-associated periplasmic binding protein dppa from helicobacter pylori in complex with peptide stsa (see paper)
27% identity, 87% coverage: 40:510/543 of query aligns to 11:481/512 of 6ofqA
8upiA Structure of a periplasmic peptide binding protein from mesorhizobium sp. Ap09 bound to aminoserine
26% identity, 91% coverage: 48:540/543 of query aligns to 12:500/510 of 8upiA
7kz9A Crystal structure of pseudomonas sp. Pdc86 substrate-binding protein aapf in complex with a signaling molecule heheaa (see paper)
26% identity, 85% coverage: 51:513/543 of query aligns to 14:453/478 of 7kz9A
1uqwA Crystal structure of ylib protein from escherichia coi
26% identity, 85% coverage: 46:508/543 of query aligns to 10:455/487 of 1uqwA
Sites not aligning to the query:
3m8uA Crystal structure of glutathione-binding protein a (gbpa) from haemophilus parasuis sh0165 in complex with glutathione disulfide (gssg) (see paper)
25% identity, 83% coverage: 84:534/543 of query aligns to 49:500/508 of 3m8uA
Sites not aligning to the query:
>15363 FitnessBrowser__Keio:15363
MTNITKRSLVAAGVLAALMAGNVALAADVPAGVTLAEKQTLVRNNGSEVQSLDPHKIEGV
PESNISRDLFEGLLVSDLDGHPAPGVAESWDNKDAKVWTFHLRKDAKWSDGTPVTAQDFV
YSWQRSVDPNTASPYASYLQYGHIAGIDEILEGKKPITDLGVKAIDDHTLEVTLSEPVPY
FYKLLVHPSTSPVPKAAIEKFGEKWTQPGNIVTNGAYTLKDWVVNERIVLERSPTYWNNA
KTVINQVTYLPIASEVTDVNRYRSGEIDMTNNSMPIELFQKLKKEIPDEVHVDPYLCTYY
YEINNQKPPFNDVRVRTALKLGMDRDIIVNKVKAQGNMPAYGYTPPYTDGAKLTQPEWFG
WSQEKRNEEAKKLLAEAGYTADKPLTINLLYNTSDLHKKLAIAASSLWKKNIGVNVKLVN
QEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSNSSMNTAHYKSPAFDSIMAETL
KVTDEAQRTALYTKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNTYTRNMYI
VKH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory