SitesBLAST
Comparing 15727 FitnessBrowser__Keio:15727 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bt9C Crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with NADP (see paper)
29% identity, 97% coverage: 8:239/240 of query aligns to 9:242/250 of 5bt9C
- active site: R18 (= R17), I140 (≠ F137), Y155 (= Y152), K159 (= K156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R18 (= R17), I19 (= I18), C38 (≠ Y37), N39 (≠ R38), R40 (≠ T39), S41 (≠ H40), L66 (≠ F59), E67 (≠ S60), N90 (= N85), S92 (= S87), I140 (≠ F137), K159 (= K156), P184 (= P181), G185 (≠ S182), T187 (≠ I184), L188 (= L185)
4iqgD Crystal structure of bpro0239 oxidoreductase from polaromonas sp. Js666 in NADP bound form
28% identity, 95% coverage: 9:237/240 of query aligns to 5:248/248 of 4iqgD
- active site: G13 (≠ R17), N112 (≠ H109), S143 (≠ D139), Y154 (≠ H149), Y157 (= Y152), K161 (= K156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G13), S11 (≠ G15), R12 (= R16), G13 (≠ R17), I14 (= I18), N32 (≠ S36), A34 (≠ R38), S35 (≠ T39), N36 (≠ H40), A59 (= A57), D60 (= D58), V61 (≠ F59), N87 (= N85), A88 (= A86), G89 (≠ S87), V141 (≠ F137), S143 (≠ D139), Y157 (= Y152), K161 (= K156), P187 (= P181), G188 (≠ S182), I190 (= I184), T192 (≠ F186), I194 (≠ E188), H195 (= H189)
4fc6B Studies on dcr shed new light on peroxisomal beta-oxidation: crystal structure of the ternary complex of pdcr (see paper)
27% identity, 96% coverage: 10:239/240 of query aligns to 30:271/276 of 4fc6B
- active site: G37 (≠ R17), A163 (≠ D139), Q173 (≠ H149), H175 (≠ A151), A176 (≠ Y152), K180 (= K156)
- binding hexanoyl-coenzyme a: G114 (≠ A88), N115 (≠ W89), F116 (≠ M90), S124 (≠ L98), N126 (≠ D100), A127 (≠ V101), T130 (≠ C104), L165 (≠ V141), R217 (≠ A192)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G33 (= G13), S36 (≠ R16), G37 (≠ R17), I38 (= I18), S57 (≠ Y37), R58 (= R38), S59 (≠ T39), R62 (vs. gap), M83 (≠ A57), D84 (= D58), V85 (≠ F59), C111 (≠ N85), A112 (= A86), A113 (≠ S87), I134 (= I108), I161 (≠ F137), K180 (= K156), P206 (= P181), G207 (≠ S182), T212 (≠ N187), E213 (= E188), G214 (≠ H189)
4fc7A Studies on dcr shed new light on peroxisomal beta-oxidation: crystal structure of the ternary complex of pdcr (see paper)
27% identity, 96% coverage: 10:239/240 of query aligns to 29:270/274 of 4fc7A
- active site: G36 (≠ R17), A162 (≠ D139), Q172 (≠ H149), H174 (≠ A151), A175 (≠ Y152), K179 (= K156)
- binding coenzyme a: R57 (= R38), R85 (≠ S60), G113 (≠ A88), N114 (≠ W89), F115 (≠ M90), S123 (≠ L98), N125 (≠ D100), A126 (≠ V101), T129 (≠ C104), R216 (≠ A192)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G32 (= G13), S35 (≠ R16), G36 (≠ R17), I37 (= I18), S56 (≠ Y37), R57 (= R38), S58 (≠ T39), R61 (vs. gap), D83 (= D58), V84 (≠ F59), R85 (≠ S60), C110 (≠ N85), A111 (= A86), A112 (≠ S87), I160 (≠ F137), K179 (= K156), P205 (= P181), G206 (≠ S182), T211 (≠ N187), E212 (= E188), G213 (≠ H189)
Q9NUI1 Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing]; pDCR; 2,4-dienoyl-CoA reductase 2; Short chain dehydrogenase/reductase family 17C member 1; EC 1.3.1.124 from Homo sapiens (Human) (see paper)
27% identity, 96% coverage: 10:239/240 of query aligns to 32:273/292 of Q9NUI1
- GGGSGI 35:40 (≠ GGGRRI 13:18) binding
- RSLPR 60:64 (≠ RTH-- 38:40) binding
- D86 (= D58) binding ; mutation to A: Reduces enzyme activity by 98%.
- D137 (≠ H109) mutation to A: Reduces enzyme activity by 97%.
- K182 (= K156) binding
- D186 (= D160) mutation to A: Reduces enzyme activity by about 95%.
- 208:214 (vs. 181:187, 29% identical) binding
- D268 (= D234) mutation to A: Reduces enzyme activity by 97%.
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
24% identity, 96% coverage: 10:239/240 of query aligns to 5:239/239 of 3sj7A
- active site: G12 (≠ R17), S138 (≠ D139), Q148 (≠ H149), Y151 (= Y152), K155 (= K156)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), S10 (≠ G15), R11 (= R16), I13 (= I18), N31 (≠ S36), Y32 (= Y37), A33 (≠ R38), G34 (≠ T39), S35 (≠ H40), A58 (= A57), N59 (≠ D58), V60 (≠ F59), N86 (= N85), A87 (= A86), T109 (≠ V110), S138 (≠ D139), Y151 (= Y152), K155 (= K156), P181 (= P181), G182 (≠ S182)
4bo8A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-(2-amino-4- phenylimidazol-1-yl)-3-(2-fluorophenyl)urea at 2.7a resolution (see paper)
25% identity, 96% coverage: 10:239/240 of query aligns to 11:235/236 of 4bo8A
4bo0A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-(4-methoxy-1- methylindazol-3-yl)-3-(2-methoxyphenyl)urea at 2.4a resolution (see paper)
25% identity, 96% coverage: 10:239/240 of query aligns to 10:234/235 of 4bo0A
4bo2A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-(1-ethylbenzimidazol-2- yl)-3-(2-methoxyphenyl)urea at 1.9a resolution (see paper)
25% identity, 96% coverage: 10:239/240 of query aligns to 13:237/238 of 4bo2A
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
24% identity, 96% coverage: 10:239/240 of query aligns to 8:246/246 of 3osuA
4iinA Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 complexed with NAD+
23% identity, 96% coverage: 9:239/240 of query aligns to 9:236/236 of 4iinA
- active site: G17 (≠ R17), S143 (≠ D139), Y156 (= Y152), K160 (= K156)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), G17 (≠ R17), I18 (= I18), N36 (≠ S36), R38 (= R38), A65 (≠ F59), N91 (= N85), A92 (= A86), G93 (≠ S87), V141 (≠ F137), S143 (≠ D139), Y156 (= Y152), K160 (= K156), P186 (= P181)
5fffA Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and piperonal (see paper)
22% identity, 96% coverage: 10:239/240 of query aligns to 15:255/257 of 5fffA
- active site: K206 (≠ Q196)
- binding 1,3-benzodioxole-5-carbaldehyde: Y100 (≠ W89), H158 (= H149)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G13), T20 (≠ G15), G22 (≠ R17), I23 (= I18), R43 (= R38), C67 (= C54), D68 (= D58), V69 (≠ F59), N96 (= N85), I146 (≠ F137), Y161 (= Y152), K165 (= K156), P191 (= P181), A193 (≠ L183), I194 (= I184), T196 (≠ F186), G198 (≠ E188), T199 (≠ H189)
5ff9B Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and tyramine (see paper)
22% identity, 96% coverage: 10:239/240 of query aligns to 15:255/257 of 5ff9B
- active site: K206 (≠ Q196)
- binding 4-(2-aminoethyl)phenol: Y100 (≠ W89), I155 (≠ S146), H158 (= H149)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G13), T20 (≠ G15), K21 (≠ R16), I23 (= I18), S42 (≠ Y37), R43 (= R38), C67 (= C54), D68 (= D58), V69 (≠ F59), N96 (= N85), I146 (≠ F137), S148 (≠ D139), Y161 (= Y152), K165 (= K156), P191 (= P181), A193 (≠ L183), I194 (= I184), T196 (≠ F186), G198 (≠ E188), T199 (≠ H189)
A0A1A9TAK5 Noroxomaritidine/norcraugsodine reductase; NorRed; EC 1.1.1.- from Narcissus pseudonarcissus (Daffodil) (see paper)
22% identity, 96% coverage: 10:239/240 of query aligns to 15:255/257 of A0A1A9TAK5
4bo9A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 5-(2-(furan-2-ylmethoxy) phenyl)-2-phenyltetrazole at 2.9a resolution (see paper)
25% identity, 96% coverage: 10:239/240 of query aligns to 11:234/235 of 4bo9A
4bo6A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 2,3-dihydroindol-1-yl-(2- thiophen-3-yl-1,3-thiazol-4-yl)methanone at 2.8a resolution (see paper)
25% identity, 96% coverage: 10:239/240 of query aligns to 11:232/233 of 4bo6A
- active site: G18 (≠ R17), S130 (≠ D139), Y140 (= Y152), K144 (= K156)
- binding 2,3-dihydroindol-1-yl-(2-thiophen-3-yl-1,3-thiazol-4-yl)methanone: F96 (≠ M90), V99 (≠ L102), N100 (≠ Q107), L103 (≠ V110), G149 (≠ N161), F150 (≠ M162)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
28% identity, 98% coverage: 5:238/240 of query aligns to 5:239/241 of 5t2uA
- active site: G17 (≠ R17), T135 (≠ D139), T145 (≠ H149), Y148 (= Y152), K152 (= K156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), G17 (≠ R17), R38 (vs. gap), D39 (vs. gap), R42 (= R38), D60 (= D58), L61 (≠ F59), N83 (≠ T76), A84 (≠ H77), Y87 (≠ L83), I133 (≠ F137), T135 (≠ D139), Y148 (= Y152), K152 (= K156), P178 (= P181), P180 (≠ L183), T181 (≠ I184), T183 (vs. gap), T185 (vs. gap), T186 (vs. gap)
2b4qA Pseudomonas aeruginosa rhlg/NADP active-site complex (see paper)
27% identity, 96% coverage: 10:239/240 of query aligns to 13:256/256 of 2b4qA
- active site: G20 (≠ R17), S148 (≠ D139), V149 (≠ Y140), Y162 (= Y152), K166 (= K156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G13), S18 (≠ G15), R19 (= R16), I21 (= I18), A40 (≠ Y37), R41 (= R38), D42 (≠ T39), D65 (= D58), L66 (≠ F59), S67 (= S60), N92 (= N85), A93 (= A86), G94 (vs. gap), I146 (≠ F137), G147 (≠ T138), S148 (≠ D139), Y162 (= Y152), K166 (= K156), P192 (= P181), G193 (≠ S182), R194 (≠ L183), F195 (≠ I184), S197 (≠ F186), M199 (≠ E188)
4bnzA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-methyl-n-phenylindole- 3-carboxamide at 2.5a resolution (see paper)
28% identity, 56% coverage: 105:239/240 of query aligns to 103:240/241 of 4bnzA
Sites not aligning to the query:
7nm8AAA Antimycin pathway standalone ketoreductase, AntM (see paper)
24% identity, 96% coverage: 10:239/240 of query aligns to 10:250/251 of 7nm8AAA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), S15 (≠ G15), R16 (= R16), G17 (≠ R17), I18 (= I18), H36 (≠ S36), Y37 (= Y37), G38 (≠ R38), H39 (≠ T39), L65 (vs. gap), N97 (= N85), G99 (≠ S87), S147 (≠ D139), Y160 (= Y152), K164 (= K156), G191 (≠ S182), T193 (≠ I184), T195 (≠ F186)
Query Sequence
>15727 FitnessBrowser__Keio:15727
MGKTQPLPILITGGGRRIGLALAWHFINQKQPVIVSYRTHYPAIDGLINAGAQCIQADFS
TNDGVMAFADEVLKSTHGLRAILHNASAWMAEKPGAPLADVLACMMQIHVNTPYLLNHAL
ERLLRGHGHAASDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNSIA
PSLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDLVDYLLTSCFVTGRSFPLDGGRHLR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory