Comparing 15743 FitnessBrowser__Keio:15743 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8bobA Structural basis for negative regulation of the maltose system (see paper)
100% identity, 100% coverage: 1:390/390 of query aligns to 1:390/390 of 8bobA
P23256 Protein MalY; EC 4.4.1.13 from Escherichia coli (strain K12) (see 2 papers)
100% identity, 100% coverage: 1:390/390 of query aligns to 1:390/390 of P23256
4dq6A Crystal structure of plp-bound putative aminotransferase from clostridium difficile 630
32% identity, 99% coverage: 2:386/390 of query aligns to 3:387/388 of 4dq6A
6qp3A Crystal structure of the plp-bound c-s lyase from bacillus subtilis (strain 168) (see paper)
34% identity, 97% coverage: 2:379/390 of query aligns to 1:379/387 of 6qp3A
3b1eA Crystal structure of betac-s lyase from streptococcus anginosus in complex with l-serine: alpha-aminoacrylate form (see paper)
33% identity, 89% coverage: 30:377/390 of query aligns to 28:376/387 of 3b1eA
3b1dA Crystal structure of betac-s lyase from streptococcus anginosus in complex with l-serine: external aldimine form (see paper)
33% identity, 89% coverage: 30:377/390 of query aligns to 28:376/387 of 3b1dA
3b1cA Crystal structure of betac-s lyase from streptococcus anginosus: internal aldimine form (see paper)
33% identity, 89% coverage: 30:377/390 of query aligns to 28:376/387 of 3b1cA
3l8aB Crystal structure of metc from streptococcus mutans
30% identity, 98% coverage: 2:385/390 of query aligns to 2:382/385 of 3l8aB
5z0qC Crystal structure of ovob (see paper)
34% identity, 99% coverage: 2:386/390 of query aligns to 1:375/379 of 5z0qC
1c7oA Crystal structure of cystalysin from treponema denticola contains a pyridoxal 5'-phosphate-l-aminoethoxyvinylglycine complex (see paper)
27% identity, 100% coverage: 1:390/390 of query aligns to 2:394/394 of 1c7oA
1c7nA Crystal structure of cystalysin from treponema denticola contains a pyridoxal 5'-phosphate cofactor (see paper)
27% identity, 100% coverage: 1:390/390 of query aligns to 2:394/394 of 1c7nA
7qugA Crystal structure of carbon-sulfur lyase fnapatb1 from fusobacterium nucleatum subspecies animalis in complex with allyl-cysteine (see paper)
28% identity, 99% coverage: 1:386/390 of query aligns to 1:394/397 of 7qugA
6qp1B Crystal structure of the plp-bound c-s lyase in the external aldimine form from staphylococcus hominis complexed with an inhibitor, l- cycloserine. (see paper)
27% identity, 99% coverage: 2:386/390 of query aligns to 8:397/398 of 6qp1B
6qp2A Crystal structure of the plp-bound c-s lyase from staphylococcus hominis (see paper)
27% identity, 99% coverage: 2:386/390 of query aligns to 1:378/383 of 6qp2A
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
22% identity, 91% coverage: 26:379/390 of query aligns to 23:375/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
22% identity, 91% coverage: 26:379/390 of query aligns to 23:375/388 of 1gd9A
6l1nA Substrate bound bacf structure from bacillus subtillis (see paper)
23% identity, 87% coverage: 39:379/390 of query aligns to 42:380/393 of 6l1nA
Sites not aligning to the query:
6l1oB Product bound bacf structure from bacillus subtillis (see paper)
23% identity, 87% coverage: 39:379/390 of query aligns to 43:381/392 of 6l1oB
Sites not aligning to the query:
6l1lB Apo-bacf structure from bacillus subtillis (see paper)
23% identity, 87% coverage: 39:379/390 of query aligns to 43:381/393 of 6l1lB
1j32A Aspartate aminotransferase from phormidium lapideum
22% identity, 91% coverage: 29:382/390 of query aligns to 31:380/388 of 1j32A
>15743 FitnessBrowser__Keio:15743
MFDFSKVVDRHGTWCTQWDYVADRFGTADLLPFTISDMDFATAPCIIEALNQRLMHGVFG
YSRWKNDEFLAAIAHWFSTQHYTAIDSQTVVYGPSVIYMVSELIRQWSETGEGVVIHTPA
YDAFYKAIEGNQRTVMPVALEKQADGWFCDMGKLEAVLAKPECKIMLLCSPQNPTGKVWT
CDELEIMADLCERHGVRVISDEIHMDMVWGEQPHIPWSNVARGDWALLTSGSKSFNIPAL
TGAYGIIENSSSRDAYLSALKGRDGLSSPSVLALTAHIAAYQQGAPWLDALRIYLKDNLT
YIADKMNAAFPELNWQIPQSTYLAWLDLRPLNIDDNALQKALIEQEKVAIMPGYTYGEEG
RGFVRLNAGCPRSKLEKGVAGLINAIRAVR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory