Comparing 15920 FitnessBrowser__Keio:15920 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
D0C9N6 Carnitine monooxygenase oxygenase subunit; Carnitine monooxygenase alpha subunit; EC 1.14.13.239 from Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / JCM 6841 / CCUG 19606 / CIP 70.34 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81) (see paper)
74% identity, 97% coverage: 10:370/374 of query aligns to 7:368/371 of D0C9N6
6y9cA The structure of a quaternary ammonium rieske monooxygenase reveals insights into carnitine oxidation by gut microbiota and inter-subunit electron transfer (see paper)
74% identity, 97% coverage: 10:370/374 of query aligns to 5:362/365 of 6y9cA
6zgpA Crystal structure of the quaternary ammonium rieske monooxygenase cnta in complex with inhibitor mmv12 (mmv020670) (see paper)
73% identity, 97% coverage: 10:370/374 of query aligns to 5:357/360 of 6zgpA
6y8sA Crystal structure of the quaternary ammonium rieske monooxygenase cnta in complex with substrate gamma-butyrobetaine (see paper)
71% identity, 97% coverage: 10:370/374 of query aligns to 4:345/348 of 6y8sA
6y8jA Crystal structure of the apo form of a quaternary ammonium rieske monooxygenase cnta (see paper)
70% identity, 97% coverage: 10:370/374 of query aligns to 4:340/343 of 6y8jA
3n0qA Crystal structure of a putative aromatic-ring hydroxylating dioxygenase (tm1040_3219) from silicibacter sp. Tm1040 at 1.80 a resolution
32% identity, 57% coverage: 14:226/374 of query aligns to 8:216/402 of 3n0qA
Sites not aligning to the query:
4qurA Crystal structure of stachydrine demethylase in complex with cyanide, oxygen, and n-methyl proline in a new orientation
34% identity, 53% coverage: 28:226/374 of query aligns to 35:229/415 of 4qurA
Sites not aligning to the query:
3vcaA Quaternary ammonium oxidative demethylation: x-ray crystallographic, resonance raman and uv-visible spectroscopic analysis of a rieske- type demethylase (see paper)
34% identity, 53% coverage: 28:226/374 of query aligns to 20:214/397 of 3vcaA
Sites not aligning to the query:
O85673 Anthranilate 1,2-dioxygenase large subunit; EC 1.14.12.1 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see 2 papers)
31% identity, 64% coverage: 21:260/374 of query aligns to 25:276/471 of O85673
3gzxA Crystal structure of the biphenyl dioxygenase in complex with biphenyl from comamonas testosteroni sp. Strain b-356 (see paper)
29% identity, 52% coverage: 19:213/374 of query aligns to 13:218/440 of 3gzxA
Sites not aligning to the query:
3en1A Crystal structure of toluene 2,3-dioxygenase (see paper)
29% identity, 52% coverage: 19:213/374 of query aligns to 12:210/424 of 3en1A
Sites not aligning to the query:
1wqlA Cumene dioxygenase (cuma1a2) from pseudomonas fluorescens ip01 (see paper)
30% identity, 52% coverage: 19:213/374 of query aligns to 13:213/436 of 1wqlA
Sites not aligning to the query:
2yflA Crystal structure of biphenyl dioxygenase variant rr41 with 2-chloro dibenzofuran (see paper)
30% identity, 52% coverage: 19:213/374 of query aligns to 13:209/433 of 2yflA
Sites not aligning to the query:
2yfjA Crystal structure of biphenyl dioxygenase variant rr41 with dibenzofuran (see paper)
30% identity, 52% coverage: 19:213/374 of query aligns to 13:209/433 of 2yfjA
Sites not aligning to the query:
5aeuA Crystal structure of ii9 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 (see paper)
30% identity, 52% coverage: 19:213/374 of query aligns to 13:209/433 of 5aeuA
Sites not aligning to the query:
2xshA Crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with 2,6 di chlorobiphenyl (see paper)
30% identity, 52% coverage: 19:213/374 of query aligns to 13:209/433 of 2xshA
Sites not aligning to the query:
8h2tB Cryo-em structure of iadd/e dioxygenase bound with iaa (see paper)
31% identity, 54% coverage: 28:229/374 of query aligns to 22:230/435 of 8h2tB
Sites not aligning to the query:
7ylsB Structure of a bacteria protein complex
31% identity, 54% coverage: 28:229/374 of query aligns to 23:231/436 of 7ylsB
Sites not aligning to the query:
2b24A Crystal structure of naphthalene 1,2-dioxygenase from rhodococcus sp. Bound to indole (see paper)
30% identity, 52% coverage: 22:216/374 of query aligns to 21:221/440 of 2b24A
Sites not aligning to the query:
2b1xA Crystal structure of naphthalene 1,2-dioxygenase from rhodococcus sp. (see paper)
30% identity, 52% coverage: 22:216/374 of query aligns to 21:221/441 of 2b1xA
Sites not aligning to the query:
>15920 FitnessBrowser__Keio:15920
MSNLSPDFVLPENFCANPQEAWTIPARFYTDQNAFEHEKENVFAKSWICVAHSSELANAN
DYVTREIIGESIVLVRGRDKVLRAFYNVCPHRGHQLLSGEGKAKNVITCPYHAWAFKLDG
NLAHARNCENVANFDSDKAQLVPVRLEEYAGFVFINMDPNATSVEDQLPGLGAKVLEACP
EVHDLKLAARFTTRTPANWKNIVDNYLECYHCGPAHPGFSDSVQVDRYWHTMHGNWTLQY
GFAKPSEQSFKFEEGTDAAFHGFWLWPCTMLNVTPIKGMMTVIYEFPVDSETTLQNYDIY
FTNEELTDEQKSLIEWYRDVFRPEDLRLVESVQKGLKSRGYRGQGRIMADSSGSGISEHG
IAHFHNLLAQVFKD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory