SitesBLAST
Comparing 16277 FitnessBrowser__Keio:16277 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2jgvB Structure of staphylococcus aureus d-tagatose-6-phosphate kinase in complex with adp (see paper)
27% identity, 94% coverage: 2:295/312 of query aligns to 3:298/314 of 2jgvB
- active site: G255 (= G252), S256 (≠ A253), G257 (= G254), D258 (= D255)
- binding adenosine-5'-diphosphate: S226 (= S223), A229 (= A226), I248 (≠ V245), P253 (≠ T250), S256 (≠ A253), G257 (= G254), N282 (≠ T279), G285 (≠ A282), M286 (≠ A283)
2jg1A Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
27% identity, 94% coverage: 2:295/312 of query aligns to 7:302/318 of 2jg1A
- active site: G259 (= G252), S260 (≠ A253), G261 (= G254), D262 (= D255)
- binding phosphoaminophosphonic acid-adenylate ester: K46 (= K41), N193 (= N187), S230 (= S223), G232 (= G225), G235 (= G228), I252 (≠ V245), V254 (= V247), G259 (= G252), S260 (≠ A253), G261 (= G254), D262 (= D255), T264 (≠ M257), N286 (≠ T279), G289 (≠ A282), M290 (≠ A283)
2jg1C Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
27% identity, 94% coverage: 2:295/312 of query aligns to 4:299/315 of 2jg1C
- active site: G256 (= G252), S257 (≠ A253), G258 (= G254), D259 (= D255)
- binding phosphoaminophosphonic acid-adenylate ester: S227 (= S223), G229 (= G225), A230 (= A226), G232 (= G228), I246 (≠ P242), I249 (≠ V245), V251 (= V247), V255 (= V251), G256 (= G252), S257 (≠ A253), G258 (= G254), D259 (= D255), T261 (≠ M257), N283 (≠ T279), G286 (≠ A282), M287 (≠ A283)
- binding 6-O-phosphono-beta-D-tagatofuranose: D17 (= D15), G42 (= G40), K43 (= K41), R93 (= R91), C95 (≠ V94), L108 (≠ N107), G140 (= G139), S141 (= S140), D259 (= D255)
2f02A Crystal structure of lacc from enterococcus faecalis in complex with atp
30% identity, 84% coverage: 5:265/312 of query aligns to 3:266/319 of 2f02A
Sites not aligning to the query:
3uqeA Crystal structure of the phosphofructokinase-2 mutant y23d from escherichia coli
32% identity, 97% coverage: 4:305/312 of query aligns to 3:307/307 of 3uqeA
- active site: G253 (= G252), A254 (= A253), G255 (= G254), D256 (= D255)
- binding adenosine-5'-triphosphate: K185 (= K185), N187 (= N187), S224 (= S223), G226 (= G225), P227 (≠ A226), G229 (= G228), S248 (≠ V247), A254 (= A253), G255 (= G254), M258 (= M257), V280 (≠ T279), G283 (vs. gap), S284 (≠ A282), T287 (≠ A285)
- binding pyrophosphate 2-: N187 (= N187), K189 (≠ R189)
3uqdB Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
33% identity, 90% coverage: 4:285/312 of query aligns to 3:286/309 of 3uqdB
- active site: G253 (= G252), A254 (= A253), G255 (= G254), D256 (= D255)
- binding adenosine-5'-diphosphate: K185 (= K185), N187 (= N187), S224 (= S223), G226 (= G225), P227 (≠ A226), G229 (= G228), S248 (≠ V247), M258 (= M257), V280 (≠ T279), G283 (≠ A282), S284 (≠ A283)
- binding adenosine-5'-triphosphate: Y23 (vs. gap), K27 (≠ E27)
- binding 6-O-phosphono-beta-D-fructofuranose: K27 (≠ E27), R29 (≠ N29)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: D14 (= D15), G39 (= G40), N43 (= N44), R90 (= R91), R105 (≠ D105), S139 (= S140), G253 (= G252)
3uqdA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
33% identity, 90% coverage: 4:285/312 of query aligns to 3:286/309 of 3uqdA
- active site: G253 (= G252), A254 (= A253), G255 (= G254), D256 (= D255)
- binding adenosine-5'-triphosphate: K185 (= K185), S224 (= S223), G226 (= G225), P227 (≠ A226), G229 (= G228), T251 (= T250), G255 (= G254), M258 (= M257), V280 (≠ T279), G283 (≠ A282), S284 (≠ A283)
- binding 6-O-phosphono-beta-D-fructofuranose: D14 (= D15), G38 (≠ A39), G39 (= G40), N43 (= N44), R90 (= R91), S139 (= S140), D256 (= D255)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: K27 (≠ E27), R29 (≠ N29)
Sites not aligning to the query:
3n1cA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with fructose-6-phosphate (see paper)
33% identity, 90% coverage: 4:285/312 of query aligns to 3:286/309 of 3n1cA
- active site: G253 (= G252), A254 (= A253), G255 (= G254), D256 (= D255)
- binding 6-O-phosphono-beta-D-fructofuranose: D14 (= D15), K27 (≠ E27), R29 (≠ N29), G39 (= G40), N43 (= N44), R90 (= R91), G138 (= G139), S139 (= S140), D256 (= D255)
P06999 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; 6-phosphofructokinase isozyme II; Phosphohexokinase 2; EC 2.7.1.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 90% coverage: 4:285/312 of query aligns to 3:286/309 of P06999
- K27 (≠ E27) binding ; binding
- KPN 185:187 (= KPN 185:187) binding in other chain
- NQK 187:189 (≠ NRR 187:189) binding in other chain
- E190 (= E190) mutation to Q: Causes a 50-fold decrease in the kcat value and a 15-fold increment in the apparent KM for ATP.
- SLGPQG 224:229 (≠ SLGAEG 223:228) binding in other chain
- S248 (≠ V247) binding in other chain
- S250 (= S249) binding
- V252 (= V251) binding
- V280 (≠ T279) binding in other chain
- S284 (≠ A283) binding in other chain
- A286 (= A285) binding
Sites not aligning to the query:
- 289 binding
- 291 binding
- 293 binding
3cqdA Structure of the tetrameric inhibited form of phosphofructokinase-2 from escherichia coli (see paper)
33% identity, 90% coverage: 4:285/312 of query aligns to 3:286/304 of 3cqdA
- active site: G253 (= G252), A254 (= A253), G255 (= G254), D256 (= D255)
- binding adenosine-5'-triphosphate: Y23 (vs. gap), G26 (= G26), K27 (≠ E27), K185 (= K185), N187 (= N187), N187 (= N187), K189 (≠ R189), S224 (= S223), G226 (= G225), P227 (≠ A226), G229 (= G228), S248 (≠ V247), T251 (= T250), A254 (= A253), G255 (= G254), M258 (= M257), V280 (≠ T279), G283 (≠ A282), S284 (≠ A283)
Sites not aligning to the query:
3ie7A The crystal structure of phosphofructokinase (lin2199) from listeria innocua in complex with atp at 1.6a
29% identity, 92% coverage: 5:290/312 of query aligns to 3:287/309 of 3ie7A
- binding adenosine-5'-triphosphate: N188 (= N187), S220 (= S223), G222 (= G225), A223 (= A226), G225 (= G228), V242 (= V245), G249 (= G252), A250 (= A253), G251 (= G254), D252 (= D255), S279 (≠ A282), V283 (= V286)
3julA Crystal structure of listeria innocua d-tagatose-6-phosphate kinase bound with substrate
29% identity, 91% coverage: 5:288/312 of query aligns to 3:278/298 of 3julA
2ajrA Crystal structure of possible 1-phosphofructokinase (ec 2.7.1.56) (tm0828) from thermotoga maritima at 2.46 a resolution
28% identity, 97% coverage: 5:307/312 of query aligns to 3:312/320 of 2ajrA
P9WID3 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; Phosphofructokinase B; Phosphohexokinase 2; Tagatose-6-phosphate kinase; EC 2.7.1.11; EC 2.7.1.144 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
29% identity, 90% coverage: 4:283/312 of query aligns to 13:293/339 of P9WID3
- K283 (≠ H273) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
3kzhA Crystal structure of a putative sugar kinase from clostridium perfringens
34% identity, 38% coverage: 184:300/312 of query aligns to 183:296/316 of 3kzhA
Sites not aligning to the query:
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
28% identity, 83% coverage: 29:287/312 of query aligns to 20:278/297 of 1tz6A
- active site: C24 (≠ T33), F88 (= F106), G238 (= G252), A239 (= A253), G240 (= G254), D241 (= D255)
- binding phosphomethylphosphonic acid adenylate ester: N149 (≠ S169), K176 (= K185), E181 (= E190), S209 (= S223), G211 (= G225), A212 (= A226), G214 (= G228), A239 (= A253), G240 (= G254), F243 (≠ M257), N270 (≠ T279), G273 (≠ A282), A274 (= A283)
- binding 5-aminoimidazole ribonucleoside: G27 (≠ L36), F88 (= F106), Y90 (≠ F108), R151 (≠ E171), M154 (vs. gap), D241 (= D255)
Sites not aligning to the query:
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
28% identity, 79% coverage: 40:287/312 of query aligns to 27:278/299 of 1tz3A
- active site: F88 (= F106), G238 (= G252), A239 (= A253), G240 (= G254), D241 (= D255)
- binding 5-aminoimidazole ribonucleoside: G27 (= G40), L83 (≠ G101), F88 (= F106), Y90 (≠ F108), R151 (≠ E171), M154 (vs. gap), D241 (= D255)
Sites not aligning to the query:
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
43% identity, 26% coverage: 207:287/312 of query aligns to 204:289/319 of Q8ZKR2
- G213 (= G216) binding
- D246 (≠ S249) binding
- T248 (≠ V251) binding
- D252 (= D255) binding
- A287 (= A285) binding
Sites not aligning to the query:
- 16 binding
- 31 binding
- 101 binding
- 162 binding
- 180 binding
- 181 binding
- 183 binding
- 290 binding
- 292 binding
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
27% identity, 81% coverage: 35:286/312 of query aligns to 35:289/312 of 3in1A
- active site: R106 (vs. gap), G255 (= G252), A256 (= A253), G257 (= G254), D258 (= D255)
- binding adenosine-5'-diphosphate: N194 (= N187), K225 (≠ S223), G227 (= G225), G230 (= G228), A244 (≠ S244), T253 (= T250), N282 (≠ T279), A285 (= A282)
7w93A Crystal structure of e.Coli pseudouridine kinase psuk complexed with n1-methyl-pseudouridine (see paper)
32% identity, 38% coverage: 184:300/312 of query aligns to 183:297/307 of 7w93A
Sites not aligning to the query:
- binding 5-[(2S,3R,4S,5R)-5-(hydroxymethyl)-3,4-bis(oxidanyl)oxolan-2-yl]-1-methyl-pyrimidine-2,4-dione: 13, 15, 39, 40, 41, 44, 96, 113, 142, 169
Query Sequence
>16277 FitnessBrowser__Keio:16277
MSRRVATITLNPAYDLVGFCPEIERGEVNLVKTTGLHAAGKGINVAKVLKDLGIDVTVGG
FLGKDNQDGFQQLFSELGIANRFQVVQGRTRINVKLTEKDGEVTDFNFSGFEVTPADWER
FVTDSLSWLGQFDMVCVSGSLPSGVSPEAFTDWMTRLRSQCPCIIFDSSREALVAGLKAA
PWLVKPNRRELEIWAGRKLPEMKDVIEAAHALREQGIAHVVISLGAEGALWVNASGEWIA
KPPSVDVVSTVGAGDSMVGGLIYGLLMRESSEHTLRLATAVAALAVSQSNVGITDRPQLA
AMMARVDLQPFN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory