Comparing 16749 FitnessBrowser__Keio:16749 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P76621 Glutarate 2-hydroxylase; G-2-H; Carbon starvation induced protein D; EC 1.14.11.64 from Escherichia coli (strain K12) (see 2 papers)
100% identity, 100% coverage: 1:325/325 of query aligns to 1:325/325 of P76621
1jr7A Crystal structure of gab reveals oxidoreductase fold (see paper)
98% identity, 96% coverage: 15:325/325 of query aligns to 1:306/306 of 1jr7A
2r6sA Crystal structure of gab protein (see paper)
94% identity, 96% coverage: 15:325/325 of query aligns to 1:299/299 of 2r6sA
6hl8A Crystal structure of the csid glutarate hydroxylase in complex with glutarate (see paper)
94% identity, 95% coverage: 16:325/325 of query aligns to 1:291/291 of 6hl8A
>16749 FitnessBrowser__Keio:16749
MNALTAVQNNAVDSGQDYSGFTLTPSAQSPRLLELTFTEQTTKQFLEQVAEWPVQALEYK
SFLRFRVAKILDDLCANQLQPLLLKTLLNRAEGALLINAVGVDDVKQADEMVKLATAVAH
LIGRSNFDAMSGQYYARFVVKNVDNSDSYLRQPHRVMELHNDGTYVEEITDYVLMMKIDE
QNMQGGNSLLLHLDDWEHLDNYFRHPLARRPMRFAAPPSKNVSKDVFHPVFDVDQQGRPV
MRYIDQFVQPKDFEEGVWLSELSDAIETSKGILSVPVPVGKFLLINNLFWLHGRDRFTPH
PDLRRELMRQRGYFAYASNHYQTHQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory