SitesBLAST
Comparing 16795 FitnessBrowser__Keio:16795 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9HTK9 Rubredoxin-NAD(+) reductase; RdxR; EC 1.18.1.1 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
34% identity, 99% coverage: 5:376/377 of query aligns to 7:380/384 of Q9HTK9
2v3aA Crystal structure of rubredoxin reductase from pseudomonas aeruginosa. (see paper)
34% identity, 99% coverage: 5:376/377 of query aligns to 4:377/381 of 2v3aA
- active site: L11 (≠ F12), K42 (= K43), P43 (= P44), M290 (≠ Q289)
- binding flavin-adenine dinucleotide: I7 (= I8), G8 (= G9), T9 (≠ S10), G10 (= G11), A12 (= A13), T33 (≠ A34), A34 (= A35), D35 (= D36), K42 (= K43), P43 (= P44), R79 (≠ W80), V80 (= V81), A105 (= A106), W106 (≠ T107), G107 (= G108), I153 (= I152), F157 (≠ L156), D274 (= D273), L284 (≠ P283), Y285 (≠ F284), V286 (≠ L285), K317 (= K316)
1xhcA Nadh oxidase /nitrite reductase from pyrococcus furiosus pfu-1140779- 001
31% identity, 88% coverage: 5:335/377 of query aligns to 3:321/346 of 1xhcA
- active site: P10 (≠ F12), K38 (= K43), P39 (= P44), F145 (≠ L151), E149 (= E155), M276 (≠ Q289)
- binding flavin-adenine dinucleotide: V6 (≠ I8), G7 (= G9), G9 (= G11), P10 (≠ F12), G11 (≠ A13), D29 (≠ A34), K30 (≠ A35), K38 (= K43), P39 (= P44), E74 (≠ Q78), A75 (≠ T79), A100 (= A106), T101 (= T107), G102 (= G108), L119 (= L125), R120 (≠ N126), F145 (≠ L151), I146 (= I152), E149 (= E155), G259 (= G272), D260 (= D273), G270 (≠ P283), T271 (≠ F284), A272 (≠ L285)
Q8U1K9 NAD(P)H:rubredoxin oxidoreductase; NROR; Rubredoxin--NAD(P)(+) reductase; EC 1.18.1.4 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
31% identity, 88% coverage: 5:335/377 of query aligns to 3:321/359 of Q8U1K9
- G11 (≠ A13) binding
- DK 29:30 (≠ AA 34:35) binding
- KP 38:39 (= KP 43:44) binding
- A75 (vs. gap) binding
- A103 (= A109) binding
- R120 (≠ N126) binding
- D260 (= D273) binding
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
30% identity, 74% coverage: 2:281/377 of query aligns to 3:291/422 of 1q1wA
- active site: L13 (≠ F12), L44 (≠ K43), P45 (= P44)
- binding flavin-adenine dinucleotide: G10 (= G9), G12 (= G11), L13 (≠ F12), A14 (= A13), G35 (≠ A34), D36 (≠ A35), L44 (≠ K43), P45 (= P44), K49 (≠ H48), V82 (= V81), A108 (= A106), T109 (= T107), G110 (= G108), R133 (≠ N126), I159 (= I152), D283 (= D273)
Sites not aligning to the query:
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
30% identity, 74% coverage: 2:281/377 of query aligns to 4:292/422 of P16640
- A15 (= A13) binding
- D37 (≠ A35) binding
- K50 (≠ H48) binding
- V83 (= V81) binding
- R134 (≠ N126) binding
- D284 (= D273) binding
Sites not aligning to the query:
6pfzA Structure of a NAD-dependent persulfide reductase from a. Fulgidus (see paper)
27% identity, 79% coverage: 5:302/377 of query aligns to 3:322/541 of 6pfzA
- active site: V37 (≠ D39), C42 (≠ P44)
- binding calcium ion: D306 (≠ Q286)
- binding coenzyme a: K14 (≠ Q16), R18 (≠ N20), R21 (≠ K23), S38 (≠ E40), G40 (≠ N42), C42 (≠ P44), K76 (≠ F71), R313 (≠ M293)
- binding flavin-adenine dinucleotide: G7 (= G9), A11 (= A13), E32 (≠ A34), A33 (= A35), R41 (≠ K43), C42 (≠ P44), A86 (≠ V81), A115 (= A106), T116 (= T107), G117 (= G108), L136 (= L125), G286 (= G272), D287 (= D273), P303 (= P283), F304 (= F284), G305 (≠ L285)
Sites not aligning to the query:
6tukB Crystal structure of fdr9 (see paper)
30% identity, 72% coverage: 5:275/377 of query aligns to 4:262/393 of 6tukB
- binding flavin-adenine dinucleotide: V7 (≠ I8), G8 (= G9), G9 (≠ S10), G10 (= G11), A12 (= A13), A34 (= A35), E35 (≠ D36), R42 (≠ K43), P43 (= P44), K47 (≠ H48), A75 (≠ F76), A76 (≠ V81), T102 (= T107), G103 (= G108), V118 (≠ L123), R119 (vs. gap), G259 (= G272), D260 (= D273)
Sites not aligning to the query:
4emjA Complex between the reductase and ferredoxin components of toluene dioxygenase (see paper)
28% identity, 73% coverage: 1:275/377 of query aligns to 1:277/406 of 4emjA
- binding flavin-adenine dinucleotide: G11 (= G11), V12 (≠ F12), G13 (≠ A13), D35 (≠ A35), E36 (≠ D36), R43 (≠ K43), P44 (= P44), S47 (= S47), K48 (≠ H48), V80 (= V81), T107 (= T107), G108 (= G108), R128 (≠ N126), G274 (= G272), D275 (= D273)
Sites not aligning to the query:
4emiA Toluene dioxygenase reductase in reduced state in complex with NAD+ (see paper)
28% identity, 72% coverage: 5:275/377 of query aligns to 4:276/402 of 4emiA
- binding flavin-adenine dinucleotide: G10 (= G11), V11 (≠ F12), G12 (≠ A13), D34 (≠ A35), E35 (≠ D36), R42 (≠ K43), P43 (= P44), K47 (≠ H48), E78 (≠ Q78), V79 (= V81), T106 (= T107), G107 (= G108), G273 (= G272), D274 (= D273)
- binding nicotinamide-adenine-dinucleotide: R111 (≠ F112), G149 (= G148), L152 (= L151), I153 (= I152), E156 (= E155), E172 (≠ D171), A173 (≠ N172), R180 (≠ S179), V236 (≠ T235), G237 (= G236), A238 (≠ L237)
Sites not aligning to the query:
2cduA The crystal structure of water-forming NAD(p)h oxidase from lactobacillus sanfranciscensis (see paper)
31% identity, 53% coverage: 81:278/377 of query aligns to 81:287/451 of 2cduA
- binding adenosine-5'-diphosphate: G158 (= G150), I160 (= I152), D179 (= D171), G180 (≠ N172), H181 (≠ A173), Y188 (≠ L180), K213 (≠ Q205), V214 (≠ L206), I243 (≠ T235), G244 (= G236)
- binding flavin-adenine dinucleotide: V81 (= V81), T112 (≠ A106), T113 (= T107), G114 (= G108), K134 (≠ L125), I160 (= I152), G281 (= G272), D282 (= D273)
Sites not aligning to the query:
- active site: 10, 37, 41, 42, 304, 450, 451
- binding flavin-adenine dinucleotide: 7, 9, 10, 11, 32, 33, 41, 42, 298, 299, 300
O84925 NADH oxidase; NOXase; EC 1.6.3.4 from Streptococcus pneumoniae (see paper)
31% identity, 54% coverage: 75:277/377 of query aligns to 75:298/459 of O84925
Sites not aligning to the query:
- 44 C→S: In Cp8054; abolishes NADH oxidase activity. Normal growth under aerobic conditions.
- 71:459 mutation Missing: In Cp8056; abolishes NADH oxidase activity. Normal growth under aerobic conditions.
2bcpA Structural analysis of streptococcus pyogenes nadh oxidase: c44s nox with azide (see paper)
30% identity, 55% coverage: 69:277/377 of query aligns to 86:313/473 of 2bcpA
Sites not aligning to the query:
- active site: 28, 56, 60, 61, 331
- binding azide ion: 60, 61
- binding flavin-adenine dinucleotide: 24, 25, 27, 28, 29, 51, 52, 60, 61, 326, 327
Q5XC60 NADH oxidase; NOXase; EC 1.6.3.4 from Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) (see paper)
30% identity, 55% coverage: 69:277/377 of query aligns to 69:296/456 of Q5XC60
- V81 (= V81) binding
- A110 (= A106) binding
- S113 (≠ A109) binding
- K143 (≠ R132) binding
- Y170 (≠ L151) binding
- D292 (= D273) binding
Sites not aligning to the query:
- 10 binding
- 12 binding
- 34 binding
- 35 binding
- 44 active site, Redox-active; binding ; modified: Cysteine sulfinic acid (-SO2H); C→S: Reduces specific activity about 13-fold, in vitro.
- 309 binding
- 310 binding
- 311 binding
- 436 binding
2bc0A Structural analysis of streptococcus pyogenes nadh oxidase: wild-type nox (see paper)
30% identity, 55% coverage: 69:277/377 of query aligns to 86:313/473 of 2bc0A
Sites not aligning to the query:
- active site: 28, 56, 60, 61, 331
- binding flavin-adenine dinucleotide: 24, 25, 27, 28, 29, 51, 52, 61, 325, 326, 327
8pxkA Structure of nadh-dependent ferredoxin reductase, bpha4, solved at wavelength 5.76 a (see paper)
29% identity, 71% coverage: 5:273/377 of query aligns to 7:270/403 of 8pxkA
- binding flavin-adenine dinucleotide: G13 (= G11), A15 (= A13), D37 (≠ A35), E38 (≠ D36), R45 (≠ K43), P46 (= P44), K50 (≠ H48), A79 (≠ P77), T106 (= T107), G107 (= G108), R127 (≠ N126), I153 (= I152), G269 (= G272), D270 (= D273)
Sites not aligning to the query:
1f3pA Ferredoxin reductase (bpha4)-nadh complex (see paper)
29% identity, 71% coverage: 5:273/377 of query aligns to 6:269/401 of 1f3pA
- active site: L13 (≠ F12), R44 (≠ K43), P45 (= P44)
- binding flavin-adenine dinucleotide: A14 (= A13), V34 (≠ I33), D36 (≠ A35), E37 (≠ D36), R44 (≠ K43), P45 (= P44), A78 (≠ P77), T105 (= T107), G106 (= G108), R126 (≠ N126), G268 (= G272), D269 (= D273)
- binding nicotinamide-adenine-dinucleotide: V147 (= V147), G148 (= G148), G150 (= G150), V151 (≠ L151), I152 (= I152), E155 (= E155), E171 (≠ D171), T172 (≠ N172), R179 (≠ S179), G230 (≠ A234), I231 (≠ T235), G232 (= G236), V233 (≠ L237)
Sites not aligning to the query:
3nt6A Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c43s/c531s double mutant (see paper)
28% identity, 75% coverage: 48:331/377 of query aligns to 48:367/565 of 3nt6A
- active site: N325 (≠ Q289)
- binding coenzyme a: A321 (≠ L285), N325 (≠ Q289), R329 (≠ M293)
- binding flavin-adenine dinucleotide: E80 (≠ W80), V81 (= V81), S112 (≠ A106), P113 (≠ T107), G114 (= G108), L133 (vs. gap), R134 (vs. gap), F161 (≠ L151), G302 (= G272), D303 (= D273), P319 (= P283), L320 (≠ F284), A321 (≠ L285)
Sites not aligning to the query:
- active site: 11, 38, 42, 43, 471, 472
- binding coenzyme a: 11, 18, 19, 22, 39, 42, 43, 459, 462, 463, 466, 534, 535
- binding flavin-adenine dinucleotide: 7, 8, 10, 11, 12, 33, 34, 42, 43
2yvjA Crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex (see paper)
29% identity, 71% coverage: 5:273/377 of query aligns to 6:269/402 of 2yvjA
- active site: L13 (≠ F12), R44 (≠ K43), P45 (= P44)
- binding flavin-adenine dinucleotide: G10 (= G9), G12 (= G11), G35 (≠ A34), D36 (≠ A35), E37 (≠ D36), R44 (≠ K43), P45 (= P44), A78 (≠ P77), T105 (= T107), G106 (= G108), R126 (≠ N126), G268 (= G272), D269 (= D273)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V147 (= V147), G148 (= G148), G149 (= G149), G150 (= G150), I152 (= I152), V170 (≠ I170), E171 (≠ D171), T172 (≠ N172), R179 (≠ S179), G230 (≠ A234), I231 (≠ T235), G232 (= G236), V233 (≠ L237)
Sites not aligning to the query:
2gr2A Crystal structure of ferredoxin reductase, bpha4 (oxidized form)
29% identity, 71% coverage: 5:273/377 of query aligns to 5:268/401 of 2gr2A
- active site: L12 (≠ F12), R43 (≠ K43), P44 (= P44)
- binding adenosine-5-diphosphoribose: R109 (vs. gap), V146 (= V147), G147 (= G148), G149 (= G150), V150 (≠ L151), I151 (= I152), E170 (≠ D171), T171 (≠ N172), R178 (≠ S179), G229 (≠ A234), I230 (≠ T235), G231 (= G236)
- binding flavin-adenine dinucleotide: G11 (= G11), A13 (= A13), D35 (≠ A35), E36 (≠ D36), R43 (≠ K43), P44 (= P44), K48 (≠ H48), A77 (≠ P77), T104 (= T107), G105 (= G108), R125 (≠ N126), G267 (= G272), D268 (= D273)
Sites not aligning to the query:
Query Sequence
>16795 FitnessBrowser__Keio:16795
MSNGIVIIGSGFAARQLVKNIRKQDATIPLTLIAADSMDEYNKPDLSHVISQGQRADDLT
RQTAGEFAEQFNLHLFPQTWVTDIDAEARVVKSQNNQWQYDKLVLATGASAFVPPVPGRE
LMLTLNSQQEYRACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASL
MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGIQATLDRQRNIEVDAVIAATGLRPE
TALARRAGLTINRGVCVDSYLQTSNTDIYALGDCAEINGQVLPFLQPIQLSAMVLAKNLL
GNNTPLKLPAMLVKIKTPELPLHLAGETQRQDLRWQINTERQGMVARGVDDADQLRAFVV
SEDRMKEAFGLLKTLPM
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory