SitesBLAST
Comparing 17164 FitnessBrowser__Keio:17164 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
27% identity, 96% coverage: 8:405/414 of query aligns to 2:418/425 of O59010
- S65 (≠ M64) mutation to V: Strongly decreased chloride conductance.
- R276 (= R265) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (= RSS 265:267) binding
- M311 (= M300) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ A303) binding
- V355 (= V344) binding
- D394 (= D381) binding
- M395 (≠ S382) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (≠ E384) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N388) binding
- D405 (= D392) mutation to N: Strongly decreased affinity for aspartate.
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
27% identity, 96% coverage: 8:403/414 of query aligns to 2:416/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: Y4 (≠ F10), Y7 (≠ L13), F46 (≠ L46), F46 (≠ L46), P75 (≠ N72), L91 (= L89), F95 (= F93), L130 (≠ I125), I133 (≠ V128), I159 (= I157), Y167 (vs. gap), K196 (≠ F183), G200 (≠ L187), I207 (= I194), F210 (= F197), L250 (= L236), I262 (≠ V250), M269 (≠ G258), T334 (≠ D323), V335 (≠ L324), G336 (≠ P325), T340 (≠ L329), L343 (≠ V332), M399 (≠ A386)
- binding aspartic acid: S277 (= S266), S278 (= S267), T314 (≠ A303), G354 (= G343), A358 (≠ G347), G359 (≠ S348), D394 (= D381), R397 (≠ E384), T398 (= T385)
- binding sodium ion: Y89 (≠ L87), T92 (≠ L90), S93 (≠ G91), G306 (= G295), T308 (= T297), N310 (= N299), N310 (= N299), M311 (= M300), D312 (≠ A301), S349 (≠ A338), I350 (≠ C339), T352 (≠ A341), N401 (= N388), V402 (≠ S389), D405 (= D392)
2nwwA Crystal structure of gltph in complex with tboa (see paper)
27% identity, 93% coverage: 18:403/414 of query aligns to 3:407/407 of 2nwwA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
27% identity, 95% coverage: 10:403/414 of query aligns to 1:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: Y4 (≠ L13), G66 (vs. gap), V83 (≠ I84), I157 (≠ G158), Y164 (vs. gap), K193 (≠ F183), T305 (= T297), I306 (= I298), I347 (≠ C339)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (= I22), M199 (≠ I189), S275 (= S267), T311 (≠ A303), G356 (≠ S348), L384 (≠ I376), D391 (= D381), R394 (≠ E384)
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
27% identity, 93% coverage: 18:403/414 of query aligns to 4:408/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
27% identity, 93% coverage: 18:403/414 of query aligns to 4:408/408 of 6bauA
- binding cysteine: S270 (= S267), M303 (= M300), T306 (≠ A303), A345 (≠ S342), G346 (= G343), V347 (= V344), G351 (≠ S348), D386 (= D381), C389 (≠ E384), T390 (= T385), N393 (= N388)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
27% identity, 96% coverage: 9:405/414 of query aligns to 1:418/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
27% identity, 96% coverage: 9:405/414 of query aligns to 1:418/427 of 5e9sA
- binding aspartic acid: R274 (= R265), S275 (= S266), S276 (= S267), T313 (≠ A303), G353 (= G343), V354 (= V344), A357 (≠ G347), G358 (≠ S348), D394 (= D381), R397 (≠ E384), T398 (= T385)
- binding decyl-beta-d-maltopyranoside: L194 (≠ F183), G198 (≠ L187), Y202 (≠ F191)
- binding sodium ion: Y87 (= Y88), T90 (≠ G91), S91 (≠ T92), S276 (= S267), G305 (= G295), A306 (= A296), T307 (= T297), N309 (= N299), N309 (= N299), M310 (= M300), D311 (≠ A301), S348 (≠ A338), I349 (≠ C339), G350 (= G340), T351 (≠ A341), N401 (= N388), V402 (≠ S389), D405 (= D392)
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
27% identity, 95% coverage: 11:405/414 of query aligns to 1:416/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
27% identity, 93% coverage: 21:405/414 of query aligns to 10:415/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ F183), G195 (≠ L187), R282 (≠ A276)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (= R265), S272 (= S266), S273 (= S267), M307 (= M300), T310 (≠ A303), G353 (= G346), A354 (≠ G347), R394 (≠ E384), T395 (= T385)
Sites not aligning to the query:
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
27% identity, 93% coverage: 21:405/414 of query aligns to 6:407/416 of 6r7rA
- binding d-aspartic acid: R263 (= R265), S265 (= S267), M299 (= M300), T302 (≠ A303), T340 (≠ A341), G342 (= G343), V343 (= V344), G347 (≠ S348), D383 (= D381), R386 (≠ E384), T387 (= T385), N390 (= N388)
- binding decyl-beta-d-maltopyranoside: H23 (≠ P38), V212 (≠ L212), A216 (= A216)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
29% identity, 73% coverage: 18:319/414 of query aligns to 4:322/396 of 6bmiA
Sites not aligning to the query:
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
27% identity, 60% coverage: 148:394/414 of query aligns to 154:393/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: M163 (≠ I157), F167 (= F161), F293 (≠ V290), V297 (≠ L294)
- binding aspartic acid: S268 (= S266), S269 (= S267), T306 (≠ A303), G346 (= G343), I347 (≠ V344), A350 (≠ G347), G351 (≠ S348), D380 (= D381), R383 (≠ E384), T384 (= T385)
Sites not aligning to the query:
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
27% identity, 60% coverage: 148:394/414 of query aligns to 147:379/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: M156 (≠ I157), F160 (= F161), F286 (≠ V290), V290 (≠ L294)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I148 (≠ Y149), S262 (= S267), S263 (≠ A268), A292 (= A296), T293 (= T297), M296 (= M300), T299 (≠ A303), G329 (= G340), A336 (≠ G347), G337 (≠ S348), D366 (= D381), R369 (≠ E384), N373 (= N388)
Sites not aligning to the query:
P43007 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Homo sapiens (Human) (see 4 papers)
28% identity, 62% coverage: 140:394/414 of query aligns to 213:469/532 of P43007
- E256 (≠ N179) to K: in SPATCCM; does not affect localization at the cell surface; decreased uptake of L-serine and L-alanine; Vmax is decreased by at least 50% for both substrates; 3-fold increase of affinity for L-serine; 2-fold increase of affinity for L-alanine; dbSNP:rs201278558
- R457 (≠ S382) to W: in SPATCCM; does not affect localization at the cell surface; loss of uptake of L-serine and L-alanine; dbSNP:rs761533681
Sites not aligning to the query:
- 201 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 206 modified: carbohydrate, N-linked (GlcNAc...) asparagine
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
29% identity, 60% coverage: 148:394/414 of query aligns to 222:469/532 of O35874
Sites not aligning to the query:
- 201 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 206 modified: carbohydrate, N-linked (GlcNAc...) asparagine
7bcsA Asct2 in the presence of the inhibitor lc-bpe (position "down") in the outward-open conformation. (see paper)
27% identity, 64% coverage: 130:394/414 of query aligns to 165:431/442 of 7bcsA
7bcqA Asct2 in the presence of the inhibitor lc-bpe (position "up") in the outward-open conformation. (see paper)
27% identity, 64% coverage: 130:394/414 of query aligns to 165:431/442 of 7bcqA
Sites not aligning to the query:
6mpbB Cryo-em structure of the human neutral amino acid transporter asct2 (see paper)
27% identity, 64% coverage: 130:394/414 of query aligns to 169:435/446 of 6mpbB
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
23% identity, 57% coverage: 148:383/414 of query aligns to 242:482/542 of P43003
- S363 (≠ R265) mutation to R: Loss of electrogenic glutamate transport. Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with M-477.
- SSS 363:365 (≠ RSS 265:267) binding
- T396 (= T297) binding
- T402 (≠ A303) binding
- IPQAG 443:447 (≠ VAGGS 344:348) binding
- D476 (≠ G377) binding
- R477 (≠ V378) mutation to M: Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with R-363.
Sites not aligning to the query:
- 483 binding
- 523 Y→F: No effect on activity.
Query Sequence
>17164 FitnessBrowser__Keio:17164
MTTQRSPGLFRRLAHGSLVKQILVGLVLGILLAWISKPAAEAVGLLGTLFVGALKAVAPI
LVLMLVMASIANHQHGQKTNIRPILFLYLLGTFSAALAAVVFSFAFPSTLHLSSSAGDIS
PPSGIVEVMRGLVMSMVSNPIDALLKGNYIGILVWAIGLGFALRHGNETTKNLVNDMSNA
VTFMVKLVIRFAPIGIFGLVSSTLATTGFSTLWGYAQLLVVLVGCMLLVALVVNPLLVWW
KIRRNPFPLVLLCLRESGVYAFFTRSSAANIPVNMALCEKLNLDRDTYSVSIPLGATINM
AGAAITITVLTLAAVNTLGIPVDLPTALLLSVVASLCACGASGVAGGSLLLIPLACNMFG
ISNDIAMQVVAVGFIIGVLQDSCETALNSSTDVLFTAAACQAEDDRLANSALRN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory