SitesBLAST
Comparing 17326 FitnessBrowser__Keio:17326 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P24182 Biotin carboxylase; Acetyl-coenzyme A carboxylase biotin carboxylase subunit A; EC 6.3.4.14 from Escherichia coli (strain K12) (see 3 papers)
100% identity, 100% coverage: 1:449/449 of query aligns to 1:449/449 of P24182
- R19 (= R19) mutation to E: Loss of homodimerization. No effect on ATP binding.
- E23 (= E23) mutation to R: Loss of homodimerization. No effect on ATP binding.
- K116 (= K116) binding
- K159 (= K159) binding
- GG 165:166 (= GG 165:166) binding
- EKYL 201:204 (= EKYL 201:204) binding
- H209 (= H209) binding
- H236 (= H236) binding
- K238 (= K238) binding
- E276 (= E276) binding ; binding
- E288 (= E288) binding ; binding
- R292 (= R292) active site; binding
- V295 (= V295) binding
- E296 (= E296) mutation to A: Severe reduction in catalytic activity.
- R338 (= R338) binding ; binding ; mutation to A: Severe reduction in catalytic activity.
- F363 (= F363) mutation to A: Loss of homodimerization. No effect on ATP binding.
- R366 (= R366) mutation to E: Loss of homodimerization. No effect on ATP binding.
1dv2A The structure of biotin carboxylase, mutant e288k, complexed with atp (see paper)
100% identity, 100% coverage: 1:447/449 of query aligns to 4:450/450 of 1dv2A
- active site: K119 (= K116), K162 (= K159), D199 (= D196), H212 (= H209), R238 (= R235), T277 (= T274), E279 (= E276), K291 (≠ E288), N293 (= N290), R295 (= R292), E299 (= E296), R341 (= R338)
- binding adenosine-5'-triphosphate: K119 (= K116), K162 (= K159), G166 (= G163), G168 (= G165), M172 (= M169), E204 (= E201), K205 (= K202), Y206 (= Y203), L207 (= L204), H239 (= H236), L281 (= L278), K291 (≠ E288)
6oi9A Crystal structure of e. Coli biotin carboxylase complexed with 7-[3- (aminomethyl)pyrrolidin-1-yl]-6-(2,6-dichlorophenyl)pyrido[2,3- d]pyrimidin-2-amine (see paper)
100% identity, 99% coverage: 1:446/449 of query aligns to 1:446/446 of 6oi9A
- active site: E276 (= E276), E288 (= E288), N290 (= N290), E296 (= E296), R338 (= R338)
- binding 7-[(3S)-3-(aminomethyl)pyrrolidin-1-yl]-6-(2,6-dichlorophenyl)pyrido[2,3-d]pyrimidin-2-amine: K159 (= K159), M169 (= M169), E201 (= E201), Y203 (= Y203), L204 (= L204), H209 (= H209), Q233 (= Q233), H236 (= H236), E276 (= E276), L278 (= L278), E288 (= E288), I437 (= I437)
2w71A Crystal structure of biotin carboxylase from e. Coli in complex with the imidazole-pyrimidine inhibitor (see paper)
100% identity, 99% coverage: 1:446/449 of query aligns to 1:446/446 of 2w71A
- active site: K116 (= K116), K159 (= K159), D196 (= D196), H209 (= H209), R235 (= R235), T274 (= T274), E276 (= E276), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R338)
- binding 4-[1-(2,6-dichlorobenzyl)-2-methyl-1H-imidazol-4-yl]pyrimidin-2-amine: K159 (= K159), Y203 (= Y203), L204 (= L204), H209 (= H209), Q233 (= Q233), H236 (= H236), L278 (= L278), I437 (= I437)
2w70A Crystal structure of biotin carboxylase from e. Coli in complex with the amino-thiazole-pyrimidine fragment (see paper)
100% identity, 99% coverage: 1:446/449 of query aligns to 1:446/446 of 2w70A
- active site: K116 (= K116), K159 (= K159), D196 (= D196), H209 (= H209), R235 (= R235), T274 (= T274), E276 (= E276), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R338)
- binding 4-(2-amino-1,3-thiazol-4-yl)pyrimidin-2-amine: I157 (= I157), K159 (= K159), G166 (= G166), M169 (= M169), E201 (= E201), Y203 (= Y203), L204 (= L204), L278 (= L278)
2w6zA Crystal structure of biotin carboxylase from e. Coli in complex with the 3-(3-methyl-but-2-enyl)-3h-purin-6-ylamine fragment (see paper)
100% identity, 99% coverage: 1:446/449 of query aligns to 1:446/446 of 2w6zA
- active site: K116 (= K116), K159 (= K159), D196 (= D196), H209 (= H209), R235 (= R235), T274 (= T274), E276 (= E276), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R338)
- binding 3-(3-methylbut-2-en-1-yl)-3H-purin-6-amine: K159 (= K159), Y203 (= Y203), L204 (= L204), L278 (= L278)
2w6qA Crystal structure of biotin carboxylase from e. Coli in complex with the triazine-2,4-diamine fragment (see paper)
100% identity, 99% coverage: 1:446/449 of query aligns to 1:446/446 of 2w6qA
- active site: K116 (= K116), K159 (= K159), D196 (= D196), H209 (= H209), R235 (= R235), T274 (= T274), E276 (= E276), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R338)
- binding 6-(2-phenoxyethoxy)-1,3,5-triazine-2,4-diamine: I157 (= I157), K159 (= K159), E201 (= E201), K202 (= K202), Y203 (= Y203), L204 (= L204), H236 (= H236), L278 (= L278)
2w6pA Crystal structure of biotin carboxylase from e. Coli in complex with 5-methyl-6-phenyl-quinazoline-2,4-diamine (see paper)
100% identity, 99% coverage: 1:446/449 of query aligns to 1:446/446 of 2w6pA
- active site: K116 (= K116), K159 (= K159), D196 (= D196), H209 (= H209), R235 (= R235), T274 (= T274), E276 (= E276), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R338)
- binding 5-methyl-6-phenylquinazoline-2,4-diamine: K159 (= K159), Y203 (= Y203), L204 (= L204), Q233 (= Q233), H236 (= H236), L278 (= L278), I437 (= I437)
2w6mA Crystal structure of biotin carboxylase from e. Coli in complex with amino-oxazole fragment series (see paper)
100% identity, 99% coverage: 1:446/449 of query aligns to 1:446/446 of 2w6mA
- active site: K116 (= K116), K159 (= K159), D196 (= D196), H209 (= H209), R235 (= R235), T274 (= T274), E276 (= E276), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R338)
- binding (2-amino-1,3-oxazol-5-yl)-(3-bromophenyl)methanone: I157 (= I157), K159 (= K159), M169 (= M169), E201 (= E201), K202 (= K202), Y203 (= Y203), H236 (= H236), L278 (= L278), I437 (= I437)
2v5aA Crystal structure of biotin carboxylase from e.Coli in complex with potent inhibitor 3 (see paper)
100% identity, 99% coverage: 1:446/449 of query aligns to 1:446/446 of 2v5aA
- active site: K116 (= K116), K159 (= K159), D196 (= D196), H209 (= H209), R235 (= R235), T274 (= T274), E276 (= E276), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R338)
- binding 7-(2,5-dihydropyrrol-1-yl)-6-phenyl-pyrido[6,5-d]pyrimidin-2-amine: I157 (= I157), K159 (= K159), M169 (= M169), E201 (= E201), Y203 (= Y203), L204 (= L204), Q233 (= Q233), H236 (= H236), L278 (= L278), I437 (= I437)
2v58A Crystal structure of biotin carboxylase from e.Coli in complex with potent inhibitor 1 (see paper)
100% identity, 99% coverage: 1:446/449 of query aligns to 1:446/446 of 2v58A
- active site: K116 (= K116), K159 (= K159), D196 (= D196), H209 (= H209), R235 (= R235), T274 (= T274), E276 (= E276), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R338)
- binding 6-(2,6-dibromophenyl)pyrido[2,3-d]pyrimidine-2,7-diamine: I157 (= I157), K159 (= K159), E201 (= E201), Y203 (= Y203), L204 (= L204), H209 (= H209), Q233 (= Q233), H236 (= H236), L278 (= L278), I437 (= I437)
3jziA Crystal structure of biotin carboxylase from e. Coli in complex with benzimidazole series (see paper)
100% identity, 99% coverage: 1:445/449 of query aligns to 1:445/445 of 3jziA
- active site: K116 (= K116), K159 (= K159), D196 (= D196), H209 (= H209), R235 (= R235), T274 (= T274), E276 (= E276), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R338)
- binding 7-amino-2-[(2-chlorobenzyl)amino]-1-{[(1S,2S)-2-hydroxycycloheptyl]methyl}-1H-benzimidazole-5-carboxamide: K116 (= K116), K159 (= K159), A160 (= A160), G164 (= G164), G165 (= G165), M169 (= M169), Y199 (= Y199), E201 (= E201), K202 (= K202), Y203 (= Y203), H209 (= H209), Q233 (= Q233), H236 (= H236), L278 (= L278), I287 (= I287), E288 (= E288)
2w6oA Crystal structure of biotin carboxylase from e. Coli in complex with 4-amino-7,7-dimethyl-7,8-dihydro-quinazolinone fragment (see paper)
100% identity, 99% coverage: 1:445/449 of query aligns to 1:445/445 of 2w6oA
- active site: K116 (= K116), K159 (= K159), D196 (= D196), H209 (= H209), R235 (= R235), T274 (= T274), E276 (= E276), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R338)
- binding 4-amino-7,7-dimethyl-7,8-dihydroquinazolin-5(6H)-one: K159 (= K159), K202 (= K202), Y203 (= Y203), L204 (= L204), L278 (= L278), I437 (= I437)
2w6nA Crystal structure of biotin carboxylase from e. Coli in complex with amino-oxazole fragment series (see paper)
100% identity, 99% coverage: 1:445/449 of query aligns to 1:445/445 of 2w6nA
- active site: K116 (= K116), K159 (= K159), D196 (= D196), H209 (= H209), R235 (= R235), T274 (= T274), E276 (= E276), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R338)
- binding 2-amino-n,n-bis(phenylmethyl)-1,3-oxazole-5-carboxamide: I157 (= I157), K159 (= K159), M169 (= M169), E201 (= E201), K202 (= K202), Y203 (= Y203), L278 (= L278)
2v59A Crystal structure of biotin carboxylase from e.Coli in complex with potent inhibitor 2 (see paper)
100% identity, 99% coverage: 1:445/449 of query aligns to 1:445/445 of 2v59A
- active site: K116 (= K116), K159 (= K159), D196 (= D196), H209 (= H209), R235 (= R235), T274 (= T274), E276 (= E276), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R338)
- binding 6-(2,6-dimethoxyphenyl)pyrido[2,3-d]pyrimidine-2,7-diamine: K159 (= K159), Y203 (= Y203), L204 (= L204), H209 (= H209), Q233 (= Q233), H236 (= H236), L278 (= L278), I437 (= I437)
3jzfB Crystal structure of biotin carboxylase from e. Coli in complex with benzimidazoles series (see paper)
100% identity, 99% coverage: 1:445/449 of query aligns to 3:447/447 of 3jzfB
- active site: K118 (= K116), K161 (= K159), D198 (= D196), H211 (= H209), R237 (= R235), T276 (= T274), E278 (= E276), E290 (= E288), N292 (= N290), R294 (= R292), E298 (= E296), R340 (= R338)
- binding 2-[(2-chlorobenzyl)amino]-1-(cyclohexylmethyl)-1H-benzimidazole-5-carboxamide: K118 (= K116), K161 (= K159), A162 (= A160), G166 (= G164), G168 (= G166), R169 (= R167), G170 (= G168), M171 (= M169), Y201 (= Y199), E203 (= E201), K204 (= K202), Y205 (= Y203), H211 (= H209), H238 (= H236), L280 (= L278), I289 (= I287), E290 (= E288)
3rupA Crystal structure of e.Coli biotin carboxylase in complex with two adp and two ca ions (see paper)
100% identity, 99% coverage: 1:444/449 of query aligns to 1:444/444 of 3rupA
- active site: K116 (= K116), K159 (= K159), D196 (= D196), H209 (= H209), R235 (= R235), T274 (= T274), E276 (= E276), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R338)
- binding adenosine-5'-diphosphate: Y82 (= Y82), G83 (= G83), K116 (= K116), K159 (= K159), G164 (= G164), G164 (= G164), G165 (= G165), G166 (= G166), R167 (= R167), M169 (= M169), F193 (= F193), E201 (= E201), K202 (= K202), Y203 (= Y203), L204 (= L204), H209 (= H209), Q233 (= Q233), H236 (= H236), K238 (= K238), L278 (= L278), E288 (= E288), R292 (= R292), V295 (= V295), E296 (= E296), R338 (= R338), D382 (= D382), I437 (= I437)
- binding calcium ion: E87 (= E87), E276 (= E276), E288 (= E288), E288 (= E288), N290 (= N290)
3g8cA Crystal structure of biotin carboxylase in complex with biotin, bicarbonate, adp and mg ion (see paper)
100% identity, 99% coverage: 1:444/449 of query aligns to 1:444/444 of 3g8cA
- active site: K116 (= K116), K159 (= K159), D196 (= D196), H209 (= H209), R235 (= R235), T274 (= T274), E276 (= E276), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R338)
- binding adenosine-5'-diphosphate: I157 (= I157), K159 (= K159), G164 (= G164), M169 (= M169), E201 (= E201), K202 (= K202), Y203 (= Y203), L204 (= L204), Q233 (= Q233), H236 (= H236), L278 (= L278), E288 (= E288), I437 (= I437)
- binding bicarbonate ion: K238 (= K238), R292 (= R292), Q294 (= Q294), V295 (= V295), E296 (= E296)
- binding biotin: Y82 (= Y82), F84 (= F84), R292 (= R292), V295 (= V295), R338 (= R338), D382 (= D382)
- binding magnesium ion: E276 (= E276), E288 (= E288)
2vr1A Crystal structure of biotin carboxylase from e. Coli in complex with atp analog, adpcf2p. (see paper)
100% identity, 99% coverage: 1:446/449 of query aligns to 1:444/444 of 2vr1A
- active site: K116 (= K116), K159 (= K159), D194 (= D196), H207 (= H209), R233 (= R235), T272 (= T274), E274 (= E276), E286 (= E288), N288 (= N290), R290 (= R292), E294 (= E296), R336 (= R338)
- binding phosphodifluoromethylphosphonic acid-adenylate ester: K159 (= K159), R165 (= R167), M167 (= M169), Y201 (= Y203), L202 (= L204), E274 (= E276), L276 (= L278), E286 (= E288), N288 (= N290), I435 (= I437)
1dv1A Structure of biotin carboxylase (apo) (see paper)
97% identity, 99% coverage: 2:446/449 of query aligns to 1:433/433 of 1dv1A
- active site: K115 (= K116), K158 (= K159), D183 (= D196), H196 (= H209), R222 (= R235), T261 (= T274), E263 (= E276), E275 (= E288), N277 (= N290), R279 (= R292), E283 (= E296), R325 (= R338)
- binding phosphate ion: K225 (= K238), R279 (= R292), Q281 (= Q294), V282 (= V295), E283 (= E296), R325 (= R338)
Query Sequence
>17326 FitnessBrowser__Keio:17326
MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSY
LNIPAIISAAEITGAVAIHPGYGFLSENANFAEQVERSGFIFIGPKAETIRLMGDKVSAI
AAMKKAGVPCVPGSDGPLGDDMDKNRAIAKRIGYPVIIKASGGGGGRGMRVVRGDAELAQ
SISMTRAEAKAAFSNDMVYMEKYLENPRHVEIQVLADGQGNAIYLAERDCSMQRRHQKVV
EEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVT
EMITGVDLIKEQLRIAAGQPLSIKQEEVHVRGHAVECRINAEDPNTFLPSPGKITRFHAP
GGFGVRWESHIYAGYTVPPYYDSMIGKLICYGENRDVAIARMKNALQELIIDGIKTNVDL
QIRIMNDENFQHGGTNIHYLEKKLGLQEK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory