SitesBLAST
Comparing 17923 FitnessBrowser__Keio:17923 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7agkA Crystal structure of e. Coli sf kinase (yihv) in complex with product sulfofructose phosphate (sfp) (see paper)
100% identity, 100% coverage: 1:298/298 of query aligns to 1:298/298 of 7agkA
- binding [(2~{S},3~{S},4~{S},5~{R})-3,4,5-tris(oxidanyl)-5-(phosphonooxymethyl)oxolan-2-yl]methanesulfonic acid: V11 (= V11), D13 (= D13), G39 (= G39), P40 (= P40), S95 (= S95), N109 (= N109), R138 (= R138), D244 (= D244)
P32143 Sulfofructose kinase; SF kinase; EC 2.7.1.184 from Escherichia coli (strain K12) (see paper)
100% identity, 100% coverage: 1:298/298 of query aligns to 1:298/298 of P32143
- D13 (= D13) binding
- K27 (= K27) binding
- G39 (= G39) binding
- S95 (= S95) binding
- R138 (= R138) binding
- D244 (= D244) binding
7ag6A Crystal structure of sf kinase yihv from e. Coli in complex with sulfofructose (sf), adp-mg (see paper)
100% identity, 100% coverage: 1:298/298 of query aligns to 1:298/302 of 7ag6A
- binding adenosine-5'-diphosphate: T212 (= T212), G214 (= G214), G217 (= G217), A242 (= A242), G243 (= G243), S268 (= S268), A271 (= A271), C275 (= C275)
- binding 6-deoxy-6-sulfo-D-fructose: I9 (= I9), V11 (= V11), D13 (= D13), G39 (= G39), P40 (= P40), S95 (= S95), N109 (= N109), R138 (= R138), D244 (= D244)
7aghA Crystal structure of sf kinase yihv from e. Coli in complex with amppnp-mg (see paper)
99% identity, 100% coverage: 1:297/298 of query aligns to 1:295/295 of 7aghA
8cqxA Ribokinase from t.Sp mutant a92g
32% identity, 98% coverage: 4:294/298 of query aligns to 2:298/300 of 8cqxA
- binding adenosine-5'-diphosphate: N179 (≠ S181), T217 (= T212), G219 (= G214), A220 (≠ S215), G222 (= G217), F250 (= F246), N272 (≠ S268), G275 (≠ A271), A276 (= A272), T279 (≠ C275)
- binding magnesium ion: D242 (= D238), T244 (= T240), A278 (≠ K274), S287 (≠ G283)
6znxC Ribokinase from thermus species
32% identity, 88% coverage: 32:294/298 of query aligns to 17:263/265 of 6znxC
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
31% identity, 99% coverage: 1:295/298 of query aligns to 1:303/306 of 4xckA
- active site: A249 (≠ G241), A250 (= A242), G251 (= G243), D252 (= D244)
- binding adenosine-5'-diphosphate: T220 (= T212), G222 (= G214), S223 (= S215), V242 (= V234), T247 (= T239), A250 (= A242), F254 (= F246), H276 (≠ S268), A279 (= A271), V283 (≠ C275)
- binding alpha-D-ribofuranose: N11 (≠ V11), D13 (= D13), G39 (= G39), K40 (≠ P40), N43 (≠ T43), A95 (≠ S95), I107 (= I106), I109 (= I108), E140 (≠ D131), T248 (= T240), D252 (= D244)
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
27% identity, 96% coverage: 9:295/298 of query aligns to 1:308/319 of Q8ZKR2
- D16 (≠ E24) binding
- G31 (= G39) binding
- Y101 (vs. gap) binding
- R162 (vs. gap) binding
- A180 (≠ V172) binding
- A181 (= A173) binding
- A183 (≠ S175) binding
- G213 (≠ T205) binding
- D246 (= D238) binding
- T248 (= T240) binding
- D252 (= D244) binding
- A287 (≠ K274) binding
- A290 (≠ R277) binding
- G292 (= G279) binding
6wk0B Crystal structure of human ribokinase in complex with amppcp and ribose
30% identity, 95% coverage: 4:285/298 of query aligns to 5:299/311 of 6wk0B
- binding phosphomethylphosphonic acid adenylate ester: N186 (≠ S181), T222 (= T212), G224 (= G214), A225 (≠ S215), G227 (= G217), T243 (≠ A231), V246 (= V234), A254 (= A242), G255 (= G243), N282 (≠ S268), A285 (= A271), A286 (= A272), V289 (≠ C275)
- binding alpha-D-ribofuranose: D14 (= D13), G40 (= G39), K41 (≠ P40), N44 (≠ T43), A96 (≠ S95), E141 (≠ R138), D256 (= D244)
5c41A Crystal structure of human ribokinase in complex with amppcp in p21 spacegroup and with 4 protomers
30% identity, 95% coverage: 4:285/298 of query aligns to 5:299/317 of 5c41A
- active site: G253 (= G241), A254 (= A242), G255 (= G243), D256 (= D244)
- binding phosphomethylphosphonic acid adenylate ester: N186 (≠ S181), T222 (= T212), G224 (= G214), A225 (≠ S215), G227 (= G217), V246 (= V234), G255 (= G243), N282 (≠ S268), A285 (= A271), A286 (= A272)
5c3yA Structure of human ribokinase crystallized with amppnp
30% identity, 95% coverage: 4:285/298 of query aligns to 4:298/306 of 5c3yA
- active site: G252 (= G241), A253 (= A242), G254 (= G243), D255 (= D244)
- binding amp phosphoramidate: T221 (= T212), G223 (= G214), V245 (= V234), T250 (= T239), G254 (= G243), N281 (≠ S268), A284 (= A271), A285 (= A272)
2fv7A Crystal structure of human ribokinase
30% identity, 95% coverage: 4:285/298 of query aligns to 4:298/308 of 2fv7A
- active site: G252 (= G241), A253 (= A242), G254 (= G243), D255 (= D244)
- binding adenosine-5'-diphosphate: N185 (≠ S181), T221 (= T212), G223 (= G214), G226 (= G217), T242 (≠ A231), V245 (= V234), A253 (= A242), G254 (= G243), N281 (≠ S268), A284 (= A271), A285 (= A272), V288 (≠ C275)
6wjzA Crystal structure of human ribokinase in complex with ampcp
30% identity, 95% coverage: 4:285/298 of query aligns to 5:299/315 of 6wjzA
- binding phosphomethylphosphonic acid adenosyl ester: N186 (≠ S181), T222 (= T212), G224 (= G214), A225 (≠ S215), G227 (= G217), T243 (≠ A231), V246 (= V234), A254 (= A242), G255 (= G243), N282 (≠ S268), A285 (= A271), A286 (= A272), V289 (≠ C275)
5byfA Crystal structure of human ribokinase in complex with amp
30% identity, 93% coverage: 8:285/298 of query aligns to 10:300/313 of 5byfA
Q9H477 Ribokinase; RK; EC 2.7.1.15 from Homo sapiens (Human)
30% identity, 93% coverage: 8:285/298 of query aligns to 22:312/322 of Q9H477
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
29% identity, 89% coverage: 31:295/298 of query aligns to 19:297/297 of 1tz6A
- active site: C24 (≠ V36), F88 (≠ K102), G238 (= G241), A239 (= A242), G240 (= G243), D241 (= D244)
- binding phosphomethylphosphonic acid adenylate ester: N149 (vs. gap), K176 (≠ A179), E181 (≠ G184), S209 (≠ T212), G211 (= G214), A212 (≠ S215), G214 (= G217), A239 (= A242), G240 (= G243), F243 (= F246), N270 (≠ S268), G273 (≠ A271), A274 (= A272)
- binding 5-aminoimidazole ribonucleoside: G27 (= G39), F88 (≠ K102), Y90 (≠ E104), R151 (vs. gap), M154 (vs. gap), D241 (= D244)
Sites not aligning to the query:
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
29% identity, 89% coverage: 31:295/298 of query aligns to 19:297/299 of 1tz3A
- active site: C24 (≠ V36), F88 (≠ K102), G238 (= G241), A239 (= A242), G240 (= G243), D241 (= D244)
- binding 5-aminoimidazole ribonucleoside: G27 (= G39), L83 (≠ I97), F88 (≠ K102), Y90 (≠ E104), R151 (vs. gap), M154 (vs. gap), D241 (= D244)
Sites not aligning to the query:
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
29% identity, 98% coverage: 7:297/298 of query aligns to 8:309/313 of 6ilsB
- binding adenosine-5'-triphosphate: N189 (≠ S181), K225 (≠ T212), G227 (= G214), I246 (vs. gap), A248 (≠ K233), A257 (= A242), G258 (= G243), F261 (= F246), A286 (= A271), S287 (≠ A272)
- binding alpha-D-ribofuranose: N12 (≠ V11), D14 (= D13), G40 (= G39), K41 (≠ P40), N44 (≠ T43), E144 (≠ R138), D259 (= D244)
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 99% coverage: 4:297/298 of query aligns to 71:375/379 of A1A6H3
Sites not aligning to the query:
- 1:74 mutation Missing: Loss of ribokinase activity.
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
30% identity, 95% coverage: 13:294/298 of query aligns to 13:302/305 of 1rk2A
- active site: A249 (≠ G241), A250 (= A242), G251 (= G243), D252 (= D244)
- binding adenosine-5'-diphosphate: T220 (= T212), G222 (= G214), S223 (= S215), A250 (= A242), G251 (= G243), H276 (≠ S268), A279 (= A271)
- binding tetrafluoroaluminate ion: G213 (vs. gap), R215 (vs. gap)
- binding magnesium ion: D246 (= D238), A282 (≠ K274), R285 (= R277), S291 (≠ G283)
- binding alpha-D-ribofuranose: D13 (= D13), G38 (= G38), G39 (= G39), K40 (≠ P40), N43 (≠ T43), E140 (≠ R138), D252 (= D244)
Sites not aligning to the query:
Query Sequence
>17923 FitnessBrowser__Keio:17923
MIRVACVGITVMDRIYYVEGLPTESGKYVARNYTEVGGGPAATAAVAAARLGAQVDFIGR
VGDDDTGNSLLAELESWGVNTRYTKRYNQAKSSQSAIMVDTKGERIIINYPSPDLLPDAE
WLEEIDFSQWDVVLADVRWHDGAKKAFTLARQAGVMTVLDGDITPQDISELVALSDHAAF
SEPGLARLTGVKEMASALKQAQTLTNGHVYVTQGSAGCDWLENGGRQHQPAFKVDVVDTT
GAGDVFHGALAVALATSGDLAESVRFASGVAALKCTRPGGRAGIPDCDQTRSFLSLFV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory