Comparing 18314 FitnessBrowser__Keio:18314 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P15028 Fe(3+) dicitrate-binding periplasmic protein FecB; Iron(III) dicitrate-binding periplasmic protein from Escherichia coli (strain K12) (see paper)
100% identity, 100% coverage: 1:300/300 of query aligns to 1:300/300 of P15028
3li2A Closed conformation of htsa complexed with staphyloferrin a (see paper)
37% identity, 89% coverage: 23:290/300 of query aligns to 5:286/288 of 3li2A
3lhsA Open conformation of htsa complexed with staphyloferrin a (see paper)
37% identity, 89% coverage: 23:290/300 of query aligns to 5:286/291 of 3lhsA
3tnyA Structure of yfiy from bacillus cereus bound to the siderophore iron (iii) schizokinen
25% identity, 90% coverage: 23:291/300 of query aligns to 4:279/280 of 3tnyA
O31567 Probable siderophore-binding lipoprotein YfiY from Bacillus subtilis (strain 168) (see paper)
25% identity, 85% coverage: 36:291/300 of query aligns to 53:321/325 of O31567
2chuA Ceue in complex with mecam (see paper)
25% identity, 84% coverage: 24:276/300 of query aligns to 14:265/283 of 2chuA
5a5vA A complex of the synthetic siderophore analogue fe(iii)-6-licam with the ceue periplasmic protein from campylobacter jejuni (see paper)
24% identity, 84% coverage: 24:276/300 of query aligns to 16:270/288 of 5a5vA
3mwfA Crystal structure of staphylococcus aureus sira complexed with staphyloferrin b
22% identity, 86% coverage: 29:286/300 of query aligns to 9:282/292 of 3mwfA
5a5dA A complex of the synthetic siderophore analogue fe(iii)-5-licam with the ceue periplasmic protein from campylobacter jejuni (see paper)
25% identity, 84% coverage: 24:276/300 of query aligns to 16:271/289 of 5a5dA
5ad1A A complex of the synthetic siderophore analogue fe(iii)-8-licam with the ceue periplasmic protein from campylobacter jejuni (see paper)
25% identity, 84% coverage: 24:276/300 of query aligns to 17:272/290 of 5ad1A
5advB The periplasmic binding protein ceue of campylobacter jejuni preferentially binds the iron(iii) complex of the linear dimer component of enterobactin (see paper)
25% identity, 84% coverage: 24:276/300 of query aligns to 14:269/287 of 5advB
5advA The periplasmic binding protein ceue of campylobacter jejuni preferentially binds the iron(iii) complex of the linear dimer component of enterobactin (see paper)
25% identity, 84% coverage: 24:276/300 of query aligns to 14:269/287 of 5advA
5od5A Periplasmic binding protein ceue complexed with a synthetic catalyst
25% identity, 84% coverage: 24:276/300 of query aligns to 15:270/288 of 5od5A
5oahA The periplasmic binding protein ceue of campylobacter jejuni binds the iron(iii) complex of azotochelin
25% identity, 84% coverage: 24:276/300 of query aligns to 15:270/288 of 5oahA
5a1jA Periplasmic binding protein ceue in complex with ferric 4-licam (see paper)
25% identity, 84% coverage: 24:276/300 of query aligns to 15:270/288 of 5a1jA
3gfvB Crystal structure of petrobactin-binding protein yclq from bacillu subtilis (see paper)
25% identity, 82% coverage: 26:271/300 of query aligns to 11:261/285 of 3gfvB
Sites not aligning to the query:
3tlkA Crystal structure of holo fepb
26% identity, 83% coverage: 24:271/300 of query aligns to 7:274/296 of 3tlkA
Sites not aligning to the query:
8bawA X-ray structure of the ceue homologue from geobacillus stearothermophilus - 5-licam siderophore analogue complex. (see paper)
24% identity, 83% coverage: 23:271/300 of query aligns to 4:255/277 of 8bawA
Sites not aligning to the query:
8b7xA X-ray structure of the ceue homologue from geobacillus stearothermophilus - apo form. (see paper)
24% identity, 83% coverage: 23:271/300 of query aligns to 3:254/276 of 8b7xA
Sites not aligning to the query:
8baxA X-ray structure of the ceue homologue from geobacillus stearothermophilus - azotochelin complex. (see paper)
24% identity, 83% coverage: 23:271/300 of query aligns to 8:259/281 of 8baxA
Sites not aligning to the query:
>18314 FitnessBrowser__Keio:18314
MLAFIRFLFAGLLLVISHAFAATVQDEHGTFTLEKTPQRIVVLELSFADALAAVDVIPIG
IADDNDAKRILPEVRAHLKPWQSVGTRAQPSLEAIAALKPDLIIADSSRHAGVYIALQQI
APVLLLKSRNETYAENLQSAAIIGEMVGKKREMQARLEQHKERMAQWASQLPKGTRVAFG
TSREQQFNLHTQETWTGSVLASLGLNVPAAMAGASMPSIGLEQLLAVNPAWLLVAHYREE
SIVKRWQQDPLWQMLTAAQKQQVASVDSNTWARMRGIFAAERIAADTVKIFHHQPLTVVK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory