Comparing 1937180 b3903 L-rhamnose isomerase (NCBI) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P32170 L-rhamnose isomerase; RhamIso; EC 5.3.1.14 from Escherichia coli (strain K12) (see paper)
100% identity, 100% coverage: 1:419/419 of query aligns to 1:419/419 of P32170
1de5A L-rhamnose isomerase (see paper)
100% identity, 100% coverage: 2:418/419 of query aligns to 1:417/417 of 1de5A
1de6A L-rhamnose isomerase (see paper)
100% identity, 99% coverage: 3:418/419 of query aligns to 1:416/416 of 1de6A
3uvaC Crystal structure of l-rhamnose isomerase mutant w38f from bacillus halodurans in complex with mn (see paper)
57% identity, 99% coverage: 5:418/419 of query aligns to 2:405/405 of 3uvaC
>1937180 b3903 L-rhamnose isomerase (NCBI)
MTTQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFENPEGSLTGGIQ
ATGNYPGKARNASELRADLEQAMRLIPGPKRLNLHAIYLESDTPVSRDQIKPEHFKNWVE
WAKANQLGLDFNPSCFSHPLSADGFTLSHADDSIRQFWIDHCKASRRVSAYFGEQLGTPS
VMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLNPAHHIDAVESKLFGIGAESYTVG
SNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDHVVL
LDDETQAIASEIVRHDLFDRVHIGLDFFDASINRIAAWVIGTRNMKKALLRALLEPTAEL
RKLEAAGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPAGSEWLESVRAYEKEILSRRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory