SitesBLAST
Comparing 199630 FitnessBrowser__MR1:199630 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A0A140FAN3 11-beta-hydroxysteroid dehydrogenase; 17-beta-hydroxysteroid dehydrogenase; Steroleosin; EC 1.1.1.146; EC 1.1.1.62 from Pinus massoniana (Chinese red pine) (see paper)
33% identity, 97% coverage: 2:260/267 of query aligns to 43:307/356 of A0A140FAN3
Sites not aligning to the query:
- 206:356 mutation Missing: Loss of binding to plant derived cholesterol, cholest-5-en-3beta-ol.
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
34% identity, 76% coverage: 8:209/267 of query aligns to 3:206/244 of 1edoA
- active site: G12 (= G17), S138 (= S142), Y151 (= Y155), K155 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), S10 (= S15), R11 (≠ E16), I13 (= I18), N31 (≠ S36), Y32 (vs. gap), A33 (= A37), R34 (= R38), S35 (≠ N39), D59 (= D63), V60 (= V64), N86 (= N90), A87 (= A91), S138 (= S142), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (≠ D186), I184 (≠ V188), S186 (= S190), M188 (≠ I192)
5yssB Crystal structure of aminocaproic acid cyclase in complex with NAD (+) (see paper)
32% identity, 83% coverage: 4:225/267 of query aligns to 2:231/255 of 5yssB
- binding nicotinamide-adenine-dinucleotide: G11 (= G13), T13 (≠ S15), S14 (≠ E16), G15 (= G17), I16 (= I18), G35 (≠ A37), F36 (≠ R38), L60 (≠ V64), N86 (= N90), G88 (= G92), I89 (≠ M93), A137 (= A141), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (≠ D186), V184 (= V188), T186 (≠ S190)
2q2qD Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida (see paper)
30% identity, 87% coverage: 4:236/267 of query aligns to 2:231/255 of 2q2qD
- active site: G15 (= G17), S138 (= S142), Y151 (= Y155), K155 (= K159), R196 (≠ A200)
- binding nicotinamide-adenine-dinucleotide: G11 (= G13), T13 (≠ S15), S14 (≠ E16), G15 (= G17), I16 (= I18), F36 (≠ R38), D59 (= D63), L60 (≠ V64), N86 (= N90), G88 (= G92), L109 (≠ V114), I136 (≠ V140), S138 (= S142), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (≠ D186), W183 (≠ F187), V184 (= V188), T186 (≠ S190), L188 (≠ I192), V189 (≠ H193)
6d9yB Crystal structure of a short chain dehydrogenase/reductase sdr from burkholderia phymatum with partially occupied NAD
36% identity, 71% coverage: 4:192/267 of query aligns to 7:195/251 of 6d9yB
- active site: G20 (= G17), S145 (= S142), Y158 (= Y155)
- binding nicotinamide-adenine-dinucleotide: G16 (= G13), R19 (≠ E16), G20 (= G17), D40 (≠ A37), L41 (≠ R38), V64 (≠ A62), D65 (= D63), Q66 (≠ V64), A93 (= A91), S145 (= S142), Y158 (= Y155), K162 (= K159), P188 (= P185), A189 (≠ D186), A190 (≠ F187), A191 (≠ V188), T193 (≠ S190)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
35% identity, 73% coverage: 1:195/267 of query aligns to 1:196/247 of P73574
- A14 (= A14) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (= P150) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K159) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (= F187) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
Sites not aligning to the query:
- 198 N→R: 3.5-fold increase in activity on acetoacetyl-CoA.
6ci9D Rmm microcompartment-associated aminopropanol dehydrogenase NADP + aminoacetone holo-structure (see paper)
32% identity, 70% coverage: 4:191/267 of query aligns to 7:195/259 of 6ci9D
- active site: G20 (= G17), S145 (= S142), Y159 (= Y155)
- binding 1-aminopropan-2-one: F97 (≠ T94), S145 (= S142), T147 (≠ A144), W156 (≠ R152), Y159 (= Y155), G190 (≠ D186)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G13), S18 (= S15), G20 (= G17), I21 (= I18), G40 (≠ A37), R41 (= R38), N42 (= N39), D66 (= D63), V67 (= V64), N93 (= N90), G95 (= G92), T143 (≠ V140), S145 (= S142), Y159 (= Y155), K163 (= K159), P189 (= P185), N191 (≠ F187), I192 (≠ V188), T194 (≠ S190)
Sites not aligning to the query:
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
35% identity, 72% coverage: 4:194/267 of query aligns to 6:193/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), S17 (= S15), R18 (≠ E16), I20 (= I18), T40 (≠ R38), N62 (≠ D63), V63 (= V64), N89 (= N90), A90 (= A91), I92 (≠ M93), V139 (= V140), S141 (= S142), Y154 (= Y155), K158 (= K159), P184 (= P185), G185 (≠ D186), I187 (≠ V188), T189 (≠ S190), M191 (≠ I192)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
35% identity, 71% coverage: 4:193/267 of query aligns to 6:192/243 of 4i08A
- active site: G19 (= G17), N113 (= N115), S141 (= S142), Q151 (≠ R152), Y154 (= Y155), K158 (= K159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), S17 (= S15), R18 (≠ E16), I20 (= I18), T40 (≠ R38), N62 (≠ D63), V63 (= V64), N89 (= N90), A90 (= A91), G140 (≠ A141), S141 (= S142), Y154 (= Y155), K158 (= K159), P184 (= P185), G185 (≠ D186), T189 (≠ S190)
3gmdA Structure-based design of 7-azaindole-pyrrolidines as inhibitors of 11beta-hydroxysteroid-dehydrogenase type i (see paper)
32% identity, 73% coverage: 4:199/267 of query aligns to 7:204/264 of 3gmdA
- active site: S145 (= S142), Y158 (= Y155), K162 (= K159)
- binding 2-methyl-3-{(3S)-1-[(1-pyridin-2-ylcyclopropyl)carbonyl]pyrrolidin-3-yl}-1H-pyrrolo[2,3-b]pyridine: T99 (= T94), S145 (= S142), Y152 (≠ V149), Y158 (= Y155), G191 (≠ D186), L192 (≠ F187), T197 (≠ I192), A198 (≠ H193)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G16 (= G13), K19 (≠ E16), G20 (= G17), I21 (= I18), R41 (= R38), S42 (≠ N39), T67 (≠ D63), M68 (≠ V64), N94 (= N89), H95 (≠ N90), I96 (≠ A91), V117 (= V114), I143 (≠ V140), S145 (= S142), Y158 (= Y155), K162 (= K159), L190 (≠ P185), G191 (≠ D186), L192 (≠ F187), I193 (≠ V188), T195 (≠ S190), T197 (≠ I192)
1xr3A Actinorhodin polyketide ketoreductase with NADP and the inhibitor isoniazid bound (see paper)
34% identity, 68% coverage: 7:188/267 of query aligns to 2:185/256 of 1xr3A
- active site: G12 (= G17), N109 (= N115), S139 (= S142), Y152 (= Y155), K156 (= K159)
- binding 4-(diazenylcarbonyl)pyridine: T140 (≠ V143), G141 (≠ A144), V146 (= V149)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), T10 (≠ S15), S11 (≠ E16), G12 (= G17), I13 (= I18), A32 (= A37), R33 (= R38), G34 (≠ N39), C57 (≠ A62), D58 (= D63), V59 (= V64), N85 (= N90), A86 (= A91), G87 (= G92), S139 (= S142), Y152 (= Y155), K156 (= K159), G183 (≠ D186), V185 (= V188)
Sites not aligning to the query:
P16544 Putative ketoacyl reductase; EC 1.3.1.- from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see 2 papers)
34% identity, 68% coverage: 7:188/267 of query aligns to 7:190/261 of P16544
- 11:39 (vs. 11:39, 34% identical) binding
- D63 (= D63) binding
- K161 (= K159) binding
2rh4B Actinorhodin ketoreductase, actkr, with NADPH and inhibitor emodin (see paper)
34% identity, 68% coverage: 7:188/267 of query aligns to 14:197/268 of 2rh4B
- active site: G24 (= G17), N121 (= N115), S151 (= S142), Y164 (= Y155), K168 (= K159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G13), T22 (≠ S15), S23 (≠ E16), I25 (= I18), A44 (= A37), R45 (= R38), G46 (≠ N39), C69 (≠ A62), D70 (= D63), V71 (= V64), N97 (= N90), S151 (= S142), Y164 (= Y155), K168 (= K159), G195 (≠ D186), V197 (= V188)
Sites not aligning to the query:
2rh4A Actinorhodin ketoreductase, actkr, with NADPH and inhibitor emodin (see paper)
34% identity, 68% coverage: 7:188/267 of query aligns to 3:186/257 of 2rh4A
- active site: G13 (= G17), N110 (= N115), S140 (= S142), Y153 (= Y155), K157 (= K159)
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: T141 (≠ V143), Q145 (≠ T147), V147 (= V149), Y153 (= Y155), F185 (= F187)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G13), T11 (≠ S15), S12 (≠ E16), G13 (= G17), I14 (= I18), A33 (= A37), R34 (= R38), G35 (≠ N39), C58 (≠ A62), D59 (= D63), V60 (= V64), N86 (= N90), G88 (= G92), S140 (= S142), Y153 (= Y155), K157 (= K159), P183 (= P185), G184 (≠ D186), V186 (= V188)
Sites not aligning to the query:
1w4zA Structure of actinorhodin polyketide (actiii) reductase (see paper)
34% identity, 68% coverage: 7:188/267 of query aligns to 5:188/259 of 1w4zA
- active site: G15 (= G17), N112 (= N115), S142 (= S142), Y155 (= Y155), K159 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G13), T13 (≠ S15), S14 (≠ E16), G15 (= G17), I16 (= I18), R36 (= R38), G37 (≠ N39), D61 (= D63), V62 (= V64), N88 (= N90), G90 (= G92), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), G186 (≠ D186), V188 (= V188)
Sites not aligning to the query:
4ijuB Crystal structure of 11b-hsd1 double mutant (l262r, f278e) in complex with (1s,4s)-4-[8-(2-fluorophenoxy)[1,2,4]triazolo[4,3-a]pyridin-3- yl]bicyclo[2.2.1]heptan-1-ol (see paper)
33% identity, 73% coverage: 4:199/267 of query aligns to 23:220/282 of 4ijuB
- active site: S161 (= S142), Y174 (= Y155), K178 (= K159)
- binding (1s,4s)-4-[8-(2-fluorophenoxy)[1,2,4]triazolo[4,3-a]pyridin-3-yl]bicyclo[2.2.1]heptan-1-ol: T115 (= T94), S161 (= S142), L162 (≠ V143), Y168 (≠ V149), Y174 (= Y155), G207 (≠ D186), A214 (≠ H193)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G32 (= G13), S34 (= S15), G36 (= G17), I37 (= I18), A56 (= A37), R57 (= R38), S58 (≠ N39), T83 (≠ D63), M84 (≠ V64), N110 (= N89), I112 (≠ A91), V159 (= V140), S161 (= S142), Y174 (= Y155), K178 (= K159), L206 (≠ P185), G207 (≠ D186), L208 (≠ F187), I209 (≠ V188), T211 (≠ S190), T213 (≠ I192), A214 (≠ H193)
4ijvA Crystal structure of 11b-hsd1 double mutant (l262r, f278e) in complex with 3-[1-(4-chlorophenyl)cyclopropyl]-8-(2-fluorophenoxy)[1,2, 4]triazolo[4,3-a]pyridine (see paper)
33% identity, 73% coverage: 4:199/267 of query aligns to 7:204/266 of 4ijvA
- active site: S145 (= S142), Y158 (= Y155), K162 (= K159)
- binding 3-[1-(4-chlorophenyl)cyclopropyl]-8-(2-fluorophenoxy)[1,2,4]triazolo[4,3-a]pyridine: T99 (= T94), S145 (= S142), Y152 (≠ V149), Y158 (= Y155), G191 (≠ D186), L192 (≠ F187), T197 (≠ I192)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G13), S18 (= S15), K19 (≠ E16), G20 (= G17), I21 (= I18), A40 (= A37), R41 (= R38), S42 (≠ N39), T67 (≠ D63), M68 (≠ V64), N94 (= N89), I96 (≠ A91), V143 (= V140), S145 (= S142), Y158 (= Y155), K162 (= K159), L190 (≠ P185), G191 (≠ D186), L192 (≠ F187), I193 (≠ V188), T195 (≠ S190), T197 (≠ I192), A198 (≠ H193)
Sites not aligning to the query:
5pgyA Crystal structure of 11beta-hsd1 double mutant (l262r, f278e) complexed with 2-[(5r,7s)-6-hydroxy-2-phenyladamantan-2-yl]-1-(3- hydroxyazetidin-1-yl)ethan-1-one (bms-816336) (see paper)
33% identity, 73% coverage: 4:199/267 of query aligns to 7:204/263 of 5pgyA
- active site: S145 (= S142), Y158 (= Y155), K162 (= K159)
- binding 2-[(5r,7s)-6-hydroxy-2-phenyladamantan-2-yl]-1-(3-hydroxyazetidin-1-yl)ethan-1-one: I96 (≠ A91), T99 (= T94), S145 (= S142), Y152 (≠ V149), V155 (≠ R152), Y158 (= Y155), L192 (≠ F187), V202 (≠ L197)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G13), S18 (= S15), K19 (≠ E16), G20 (= G17), I21 (= I18), R41 (= R38), S42 (≠ N39), T67 (≠ D63), M68 (≠ V64), N94 (= N89), I96 (≠ A91), V143 (= V140), S145 (= S142), Y158 (= Y155), K162 (= K159), L190 (≠ P185), G191 (≠ D186), L192 (≠ F187), I193 (≠ V188), T195 (≠ S190), T197 (≠ I192), A198 (≠ H193)
4ijwA Crystal structure of 11b-hsd1 double mutant (l262r, f278e) in complex with 3-[1-(4-chlorophenyl)cyclopropyl]-8-cyclopropyl[1,2, 4]triazolo[4,3-a]pyridine (see paper)
33% identity, 73% coverage: 4:199/267 of query aligns to 7:204/263 of 4ijwA
- active site: S145 (= S142), Y158 (= Y155), K162 (= K159)
- binding 3-[1-(4-chlorophenyl)cyclopropyl]-8-cyclopropyl[1,2,4]triazolo[4,3-a]pyridine: I96 (≠ A91), S145 (= S142), Y152 (≠ V149), Y158 (= Y155), G191 (≠ D186), L192 (≠ F187), A198 (≠ H193)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G13), S18 (= S15), K19 (≠ E16), G20 (= G17), I21 (= I18), R41 (= R38), S42 (≠ N39), T67 (≠ D63), M68 (≠ V64), N94 (= N89), I96 (≠ A91), V143 (= V140), S145 (= S142), Y158 (= Y155), K162 (= K159), L190 (≠ P185), G191 (≠ D186), I193 (≠ V188), T195 (≠ S190), T197 (≠ I192), A198 (≠ H193)
4k1lA 4,4-dioxo-5,6-dihydro-[1,4,3]oxathiazines, a novel class of 11 beta- hsd1 inhibitors for the treatment of diabetes (see paper)
33% identity, 73% coverage: 4:199/267 of query aligns to 12:209/263 of 4k1lA
- active site: S150 (= S142), Y163 (= Y155), K167 (= K159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G21 (= G13), S23 (= S15), K24 (≠ E16), G25 (= G17), I26 (= I18), R46 (= R38), S47 (≠ N39), T72 (≠ D63), M73 (≠ V64), N99 (= N89), H100 (≠ N90), I101 (≠ A91), V148 (= V140), S150 (= S142), Y163 (= Y155), K167 (= K159), L195 (≠ P185), G196 (≠ D186), I198 (≠ V188), T200 (≠ S190), T202 (≠ I192), A203 (≠ H193)
- binding (4aS,8aR)-N-cyclohexyl-4a,5,6,7,8,8a-hexahydro-4,1,2-benzoxathiazin-3-amine 1,1-dioxide: I101 (≠ A91), T104 (= T94), L151 (≠ V143), A152 (= A144), Y157 (≠ V149), Y163 (= Y155), G196 (≠ D186), V207 (≠ L197)
Query Sequence
>199630 FitnessBrowser__MR1:199630
MDGLTGKVVIITGASEGIGRALAIAMARIGCQLVLSARNETRLASLALEVANYGPTPFVF
AADVSSASQCEDLIHATIAHYGRIDILVNNAGMTMWSRFDELTQLSVLEDIMRVNYLGPA
YLTHAALPYLKSSQGQVVIVASVAGLTGVPTRSGYAASKHAVIGFFDSLRIELADDNVAV
TVICPDFVVSQIHKRALDGAGKPLGKSPMQEAKILSAEQCANMMLPVIATRGRLLITSLR
GRLGRWLKLIAPGLIDKIARKAIASGR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory