SitesBLAST
Comparing 201027 FitnessBrowser__MR1:201027 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7o12B Abc transporter nosdfy, amppnp-bound in gdn (see paper)
40% identity, 68% coverage: 4:207/302 of query aligns to 3:203/298 of 7o12B
7o17B Abc transporter nosdfy e154q, atp-bound in lipid nanodisc (see paper)
39% identity, 68% coverage: 4:207/302 of query aligns to 3:203/298 of 7o17B
- binding adenosine-5'-triphosphate: Y12 (= Y13), V17 (≠ A18), N37 (= N38), G38 (= G39), A39 (= A40), G40 (= G41), K41 (= K42), T42 (= T43), T43 (= T44), E80 (≠ Q81), R123 (≠ Q128), T127 (≠ S132), S129 (= S134), K130 (≠ H135), G131 (= G136), M132 (= M137)
- binding magnesium ion: K41 (= K42), T42 (= T43)
E9Q876 Glucosylceramide transporter ABCA12; ATP-binding cassette sub-family A member 12; EC 7.6.2.1 from Mus musculus (Mouse) (see 2 papers)
35% identity, 69% coverage: 3:209/302 of query aligns to 2253:2467/2595 of E9Q876
Sites not aligning to the query:
- 1388:1461 ISMLTGLFGATAGTIFVYGKDIKTDLNTVRKNMGVCMQHDVLFSYLTTKEHLLLYGSIKVPHWTKTQLHEEVKR→M: In a mouse model for harlequin ichthyosis (HI), smooth skin (smsk) mutant mice show a pronounced perinatal lethal skin phenotype in 25% of the offspring and newborn mutant pups die within a few hours after birth, and appear severely dehydrated with dry cracking skin. Smsk homozygous mutants embryos show a normal appearance at 14.5 dpc, but at 16.5 dpc develop a partial absence of normal skin folds around the trunk and limbs, and by 18.5 dpc develop a taut, thick skin and limb contractures.
- 1996 G→D: In a mouse model for harlequin ichthyosis (HI), homozygous mice are embryonic lethal but occasionally pups are found in the first few hours after birth but die and are severely dehydrated and fail to suckle normally. Homozygous pups show hallmarks of HI desease including hyperkeratosis, abnormal extracellular lipid lamellae and defects in cornified envelope processing. At 14.5 dpc and 15.5 dpc homozygous embryos appear normal; however from 16.5 dpc onwards they are characterized by an absence of normal skin folds around the trunk and limbs. As development progressed, embryos develop a taut, thick epidermis and multiple contractures affecting the limbs. Late stage embryos are smaller.
O95477 Phospholipid-transporting ATPase ABCA1; ATP-binding cassette sub-family A member 1; ATP-binding cassette transporter 1; ABC-1; ATP-binding cassette 1; Cholesterol efflux regulatory protein; EC 7.6.2.1 from Homo sapiens (Human) (see 35 papers)
33% identity, 76% coverage: 4:233/302 of query aligns to 899:1136/2261 of O95477
- D917 (≠ N20) to Y: in a colorectal cancer sample; somatic mutation
- T929 (≠ I32) to I: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; loss protein subcellular localization to the plasma membrane; dbSNP:rs1832457117
- N935 (= N38) to S: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; dbSNP:rs28937313
- K939 (= K42) mutation to M: Inhibits ATPase activity; when associated with M-1952. Decreases translocase activity; when associated with M-1952. Does not affect protein subcellular localization in plasma membrane and endosome; when associated with M-1952.
- S1042 (≠ A142) modified: Phosphoserine; by PKA
- P1065 (= P165) natural variant: P -> S
- M1091 (≠ L191) to T: in FHA1; loss of localization to plasma membrane; decreased cholesterol efflux; decreased phospholipid efflux
- C1110 (vs. gap) modified: S-palmitoyl cysteine; mutation to S: Decreased palmitoylation; when associated with S-3, S-23 and S-1111.
- C1111 (vs. gap) modified: S-palmitoyl cysteine; mutation to S: Decreased palmitoylation; when associated with S-3, S-23 and S-1110.
Sites not aligning to the query:
- 3 modified: S-palmitoyl cysteine; C→S: Mild decrease of palmitoylation. Loss of localization to plasma membrane. Decreased cholesterol efflux. Decreased phospholipid efflux. Decreased palmitoylation; when associated with S-23, S-1110 and S-1111.
- 23 modified: S-palmitoyl cysteine; C→S: Mild decrease of palmitoylation. Loss of localization to plasma membrane. Decreased palmitoylation; when associated with S-3, S-1110 and S-1111.
- 74 I→C: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-371.; I→K: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with E-371.
- 75 modified: Disulfide link with 309
- 85 P → L: in FHA1; Alabama; dbSNP:rs145183203
- 98 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 100 S→C: Highly decreased protein abundance. Highly decreased ATPase activity. Highly decreased phospholipid translocase activity.
- 210 E → D: in a colorectal cancer sample; somatic mutation
- 219 R → K: in dbSNP:rs2230806
- 230 R → C: in dbSNP:rs9282541
- 244 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 248 P → A: in dbSNP:rs142625938
- 255 A → T: in TGD; deficient cellular cholesterol efflux; dbSNP:rs758100110
- 304 V→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane; when associated with C-308.
- 308 V→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane; when associated with C-304.
- 309 modified: Disulfide link with 75
- 364 S → C: in dbSNP:rs775035559
- 371 I→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane. 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-74 or C-375.; I→E: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-74.
- 375 L→C: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-371.
- 399 V → A: in dbSNP:rs9282543
- 401 K → Q: in dbSNP:rs138487227
- 496 R → W: in dbSNP:rs147675550
- 568 K→A: 60-65% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane.
- 573 Y→F: No effect on phospholipid and cholesterol efflux and on localization to cell membrane.
- 581 D→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-584 and K-585.
- 583 F→K: 90-95% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with E-590.
- 584 E→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-581 and K-585.
- 585 D→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-581 and K-584.
- 590 W → S: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; dbSNP:rs137854496; W→E: 90-95% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-583.
- 593 F→L: Moderately decreased protein abundance. Highly decreased ATPase activity. Highly decreased phospholipid translocase activity.
- 638 R → Q: in dbSNP:rs374190304
- 771 V → M: in dbSNP:rs2066718
- 774 T → P: in dbSNP:rs35819696; natural variant: T -> S
- 776 K → N: in dbSNP:rs138880920
- 815 E → G: in dbSNP:rs145582736
- 825 V → I: in dbSNP:rs2066715
- 883 I → M: in dbSNP:rs2066714
- 1172 E → D: in dbSNP:rs33918808
- 1181 S → F: in dbSNP:rs76881554
- 1216 G → V: in dbSNP:rs562403512
- 1341 R → T: in dbSNP:rs147743782
- 1376 S → G: in dbSNP:rs145689805
- 1379 L → F: in TGD; the mutant protein is retained in the endoplasmic reticulum while the wild-type protein is located at the plasma membrane; dbSNP:rs1831213945
- 1407 A → T: in a colorectal cancer sample; somatic mutation; dbSNP:rs189206655
- 1463 modified: Disulfide link with 1477
- 1477 modified: Disulfide link with 1463; C → R: in TGD; loss of interaction with APOE; unable to generate APOE-containing high density lipoproteins; moderately decreased protein abundance; moderately decreased ATPase activity; moderately decreased phospholipid translocase activity; dbSNP:rs137854494
- 1512 T→M: Moderately decreased protein abundance. Does not affect ATPase activity. Moderately decreased phospholipid translocase activity.
- 1555 I → T: in dbSNP:rs1997618
- 1587 K → R: in dbSNP:rs2230808
- 1611 N → D: in FHA1; deficient cellular cholesterol efflux
- 1615 R → Q: in dbSNP:rs1251839800
- 1648 L → P: in dbSNP:rs1883024
- 1670 A → T: in dbSNP:rs1203589782
- 1680 R → Q: in dbSNP:rs150125857
- 1704 V → D: in TGD; the mutant protein is retained in the endoplasmic reticulum while the wild-type protein is located at the plasma membrane
- 1731 S → C: in dbSNP:rs760507032
- 1897 R → W: in FHA1; uncertain significance; dbSNP:rs760768125
- 1925 R → Q: in Scott syndrome; shows impaired trafficking of the mutant protein to the plasma membrane; dbSNP:rs142688906
- 1952 K→M: Inhibits ATPase activity; when associated with M-939. Decreases translocase activity; when associated with M-939. Does not affect protein subcellular localization in plasma membrane and endosome; when associated with M-939.
- 2054 modified: Phosphoserine; by PKA
- 2081 R → W: in TGD; highly decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; loss protein subcellular localization to the plasma membrane; dbSNP:rs137854501
- 2109 A → T: in a colorectal cancer sample; somatic mutation
- 2150 P → L: in FHA1; moderately decreased protein abundance; does not affect ATPase activity; moderately decreased phospholipid translocase activity; dbSNP:rs369098049
- 2163 natural variant: F -> S
- 2168 L → P: in dbSNP:rs2853577
- 2243 D → E: in dbSNP:rs34879708
- 2244 V → I: in dbSNP:rs144588452
7tbwA The structure of atp-bound abca1 (see paper)
32% identity, 92% coverage: 4:280/302 of query aligns to 754:1043/1928 of 7tbwA
- binding adenosine-5'-triphosphate: Y763 (= Y13), D765 (vs. gap), K768 (= K16), N790 (= N38), G791 (= G39), G793 (= G41), K794 (= K42), T795 (= T43), Q835 (= Q81), Q887 (≠ S132), S889 (= S134), H944 (= H189)
- binding magnesium ion: Q835 (= Q81), D912 (= D157), Q913 (≠ E158)
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 1630, 1633, 1657, 1658, 1660, 1661, 1662, 1663, 1702, 1753, 1755, 1756, 1757, 1779, 1783, 1811
- binding cholesterol: 218, 219, 360, 367
- binding magnesium ion: 1662, 1702
8ee6A Cryo-em structure of human abca7 in pe/ch nanodiscs (see paper)
31% identity, 92% coverage: 4:282/302 of query aligns to 624:904/1808 of 8ee6A
Sites not aligning to the query:
7roqA Alternative structure of human abca1
33% identity, 71% coverage: 15:228/302 of query aligns to 783:1001/1831 of 7roqA
Sites not aligning to the query:
P41233 Phospholipid-transporting ATPase ABCA1; ATP-binding cassette sub-family A member 1; ATP-binding cassette transporter 1; ABC-1; ATP-binding cassette 1; EC 7.6.2.1 from Mus musculus (Mouse) (see paper)
33% identity, 76% coverage: 4:233/302 of query aligns to 899:1136/2261 of P41233
Sites not aligning to the query:
- 489 modified: carbohydrate, N-linked (GlcNAc...) asparagine
8y1pA Cryo-em structure of human abca7 in dops-bound state
31% identity, 91% coverage: 8:282/302 of query aligns to 648:922/1800 of 8y1pA
Sites not aligning to the query:
- binding O-[(S)-({(2R)-2,3-bis[(9Z)-octadec-9-enoyloxy]propyl}oxy)(hydroxy)phosphoryl]-L-serine: 21, 24, 46, 371, 432, 440, 448, 452, 455, 1147
Q99758 Phospholipid-transporting ATPase ABCA3; ABC-C transporter; ATP-binding cassette sub-family A member 3; ATP-binding cassette transporter 3; ATP-binding cassette 3; Xenobiotic-transporting ATPase ABCA3; EC 7.6.2.1; EC 7.6.2.2 from Homo sapiens (Human) (see 15 papers)
31% identity, 79% coverage: 4:241/302 of query aligns to 530:777/1704 of Q99758
- N568 (= N38) to D: in SMDP3; does not affect location in intracellular vesicle membrane; does not affect proteolytic cleavage; does not affect N-glycosylation; loss of ATP hydrolysis activity; decreases ATP binding in vitro; does not affect protein expression; does not affect multivesicular bodies and lamellar bodies location; affects multivesicular bodies and lamellar bodies development; loss of phosphatidylcholine transport; does not affect cholesterol transport; dbSNP:rs121909184
- L579 (= L49) to P: in SMDP3; uncertain significance
- R605 (≠ L73) to Q: in SMDP3; uncertain significance; dbSNP:rs760006956
- S693 (≠ A161) mutation to L: Does not affect protein oligomerization.
- P766 (vs. gap) to S: in dbSNP:rs45592239
Sites not aligning to the query:
- 43 R → L: in SMDP3; uncertain significance
- 53 N→Q: Does not affect N-glycosylation. Does not affect protein expression. Does not affect lamellar body membrane location.
- 101 L → P: in SMDP3; loss of intracellular vesicle membrane location; loss of proteolytic cleavage; does not affect N-glycosylation; loss of ATP hydrolysis activity; decreases ATP binding in vitro; dbSNP:rs121909182
- 124 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Loss of N-glycosylation. Reduces protein expression by 50%. Affects anterograde trafficking; when associated with Q-140. Reduces protein expression by 85%; when associated with Q-140. Does not affect lamellar body membrane location.
- 140 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N → H: in dbSNP:rs45447801; N→Q: Loss of N-glycosylation. Reduces protein expression by 50%. Affects anterograde trafficking; when associated with Q-124. Reduces protein expression by 85%; when associated with Q-140. Does not affect lamellar body membrane location.
- 173:174 LK→AA: Loss of proteolytic processing.
- 174:175 Cleavage; by CTSL
- 215 Q → K: in SMDP3; loss of lamellar bodies membrane location; loss of proteolytic cleavage; increases cellular free cholesterol and phosphatidylcholine transport; loss of vesicles formation; increases free cholesterol induced cell death; loss of protein oligomerization; dbSNP:rs879159551
- 280 R → C: in SMDP3; uncertain significance; does not affect protein oligomerization; dbSNP:rs201299260
- 288 R → K: in SMDP3; uncertain significance; does not affect protein oligomerization; dbSNP:rs117603931
- 290 L → M: in a breast cancer sample; somatic mutation
- 292 E → V: in SMDP3; uncertain significance; does not affect lamellar bodies membrane location; does not affect proteolytic cleavage; affects lamellar bodies formation; does not affect cholesterol and phosphatidylcholine transport; decreases vesicles formation; does not affect free cholesterol induced cell death; dbSNP:rs149989682
- 801 E → D: in a breast cancer sample; somatic mutation
- 945 N→Q: Does not affect lamellar body membrane location. Does not affect protein expression. Does not affect proteolytic processing.
- 982 L → P: in SMDP3; loss of intracellular vesicle membrane location; loss of proteolytic cleavage; does not affect N-glycosylation; dbSNP:rs1402761450
- 1069 H → Q: in a breast cancer sample; somatic mutation
- 1076 N → K: in SMDP3; uncertain significance; dbSNP:rs2093663770
- 1221 G → S: in SMDP3; does not affect intracellular vesicle membrane location; does not affect proteolytic cleavage; does not affect N-glycosylation; loss of ATP hydrolysis activity; G→A: Decreases ATP hydrolysis activity of 15% compared to the wild-type.; G→T: Decreases ATP hydrolysis activity of 36% compared to the wild-type.; G→V: Decreases ATP hydrolysis activity of 18% compared to the wild-type.
- 1302 G → E: in SMDP3; uncertain significance; dbSNP:rs2093657978
- 1388 K → N: in SMDP3; decreases phosphatidylcholine transport; increases protein abundance; does not affect folding in the endoplasmic reticulum; decreases proteolytic processing; affects lamellar bodies development; reduces free cholesterol transport
- 1553 L → P: in SMDP3; loss of intracellular vesicle membrane location; loss of proteolytic cleavage; does not affect N-glycosylation; dbSNP:rs121909183
- 1580 L → P: in SMDP3; does not affect location in intracellular vesicle membrane; does not affect proteolytic cleavage; does not affect N-glycosylation; loss of ATP hydrolysis activity; decreases ATP binding in vitro; affects the intracellular vesicles development; decreases phosphatidylcholine transport; L→A: Decreases ATP hydrolysis activity of 13% compared to the wild-type.; L→F: Decreases ATP hydrolysis activity of 13% compared to the wild-type.; L→V: Decreases ATP hydrolysis activity of 56% compared to the wild-type.
- 1591 Q → P: in SMDP3; loss of intracellular vesicle membrane location; loss of proteolytic cleavage; does not affect N-glycosylation; dbSNP:rs28936691
Q8R420 Phospholipid-transporting ATPase ABCA3; ATP-binding cassette sub-family A member 3; Xenobiotic-transporting ATPase ABCA3; EC 7.6.2.1; EC 7.6.2.2 from Mus musculus (Mouse) (see paper)
31% identity, 79% coverage: 4:241/302 of query aligns to 530:777/1704 of Q8R420
Sites not aligning to the query:
- 292 E→V: Knockin new born mice are healthy and survive into adulthood without overt signs of respiratory distress. Knockin mice show a severe lung phenotype that begins with alveolar inflammatory cell infiltration at the early stage of the mouse life followed by aberrant lung remodeling with characteristics of diffuse parenchymal lung disease (DPLD)- and emphysema-like alveolar disruption in older mice.
Q8IUA7 ATP-binding cassette sub-family A member 9; EC 7.6.2.- from Homo sapiens (Human) (see 2 papers)
31% identity, 75% coverage: 1:225/302 of query aligns to 1282:1517/1624 of Q8IUA7
- K1306 (vs. gap) to T: in dbSNP:rs2302294
Sites not aligning to the query:
- 353 R → H: in dbSNP:rs1860447
- 949 modified: carbohydrate, N-linked (GlcNAc...) asparagine
7w02A Cryo-em structure of atp-bound abca3 (see paper)
30% identity, 79% coverage: 4:241/302 of query aligns to 495:742/1566 of 7w02A
- binding adenosine-5'-triphosphate: F504 (≠ Y13), N533 (= N38), G534 (= G39), G536 (= G41), K537 (= K42), T538 (= T43), T539 (= T44), Q578 (= Q81), L630 (= L133), S631 (= S134)
- binding magnesium ion: T538 (= T43), Q578 (= Q81)
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 1277, 1305, 1306, 1307, 1308, 1309, 1310, 1344, 1395, 1398
- binding magnesium ion: 1310, 1344
7tbyA The structure of human abca1 in nanodisc (see paper)
32% identity, 84% coverage: 4:257/302 of query aligns to 691:942/1788 of 7tbyA
Sites not aligning to the query:
Q9BZC7 ATP-binding cassette sub-family A member 2; ATP-binding cassette transporter 2; ATP-binding cassette 2; EC 7.6.2.- from Homo sapiens (Human) (see paper)
32% identity, 69% coverage: 3:209/302 of query aligns to 988:1199/2435 of Q9BZC7
Sites not aligning to the query:
- 271 modified: N5-methylglutamine; Q→R: Abolishes methylation by N6AMT1.
8eopA Cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state (see paper)
35% identity, 68% coverage: 4:209/302 of query aligns to 650:859/1687 of 8eopA
- binding adenosine-5'-triphosphate: F659 (≠ Y13), S662 (vs. gap), A666 (= A18), N686 (= N38), G687 (= G39), G689 (= G41), K690 (= K42), T691 (= T43), T692 (= T44), H782 (≠ S132), S784 (= S134)
Sites not aligning to the query:
P34358 ABC transporter ced-7; Cell death protein 7 from Caenorhabditis elegans (see 2 papers)
35% identity, 65% coverage: 16:212/302 of query aligns to 560:758/1704 of P34358
- K586 (= K42) mutation to R: Cell corpses not engulfed.
- E639 (≠ S93) mutation to G: Cell corpses not engulfed.
Sites not aligning to the query:
- 126 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 1012 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 1045 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 1417 K→R: Some cell corpses not engulfed.
Q5SSE9 ATP-binding cassette sub-family A member 13; EC 7.6.2.- from Mus musculus (Mouse) (see paper)
34% identity, 67% coverage: 9:209/302 of query aligns to 3815:4020/5034 of Q5SSE9
- K3849 (= K42) mutation to M: Does not affect intracellular vesicle localization. Affects cholesterol internalization.
- T3999 (≠ S188) mutation to A: Does not affect protein expression. Affects intracellular vesicles localization. Impairs intracellular cholesterol accumulation in the vesicle.
Sites not aligning to the query:
- 3577 H→P: Does not affect protein expression. Decreases intracellular cholesterol accumulation in the vesicle.
- 4735 K→M: Does not affect intracellular vesicle localization.Affects cholesterol internalization.
- 4818 R→C: Does not affect protein expression. Decreases intracellular cholesterol accumulation in the vesicle.
8k1oB Mycobacterial efflux pump, amppnp bound state (see paper)
33% identity, 70% coverage: 4:215/302 of query aligns to 6:215/215 of 8k1oB
8k1pB Mycobacterial efflux pump, adp+vanadate bound state
33% identity, 70% coverage: 4:215/302 of query aligns to 4:213/213 of 8k1pB
Query Sequence
>201027 FitnessBrowser__MR1:201027
MILVQCQGLSKHYGNKKALNNVSLTLEAGAPIALVGPNGAGKTTLFSLLCGYLTPSAGTV
RILGEAPNSPTLLGQIAALPQDATLDPNLTIISQLSFFARLQGMDSKQANQEALRVLNLV
DLAEVAQQKPPSLSHGMSKRVAIAQALIGSPKLVLLDEPTAGLDPANAKKIRELVRILSP
TTTFVISSHNLDELEKLCDQVLYLDKGELSQSISMRSSNSGSDYLTLTMQSCDSEALIQA
VGQIAGVVNITSKQAHVFVIQLDDTANRHYEFETALLALFKQQHWQYKMLLKGRTLEETL
FS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory