Comparing 202036 FitnessBrowser__MR1:202036 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09373 Formate acetyltransferase 1; Pyruvate formate-lyase 1; EC 2.3.1.54 from Escherichia coli (strain K12) (see 4 papers)
81% identity, 100% coverage: 1:760/760 of query aligns to 1:760/760 of P09373
1h16A Pyruvate formate-lyase (e.Coli) in complex with pyruvate and coa (see paper)
81% identity, 100% coverage: 2:760/760 of query aligns to 1:759/759 of 1h16A
1cm5A Crystal structure of c418a,c419a mutant of pfl from e.Coli (see paper)
81% identity, 100% coverage: 2:760/760 of query aligns to 1:759/759 of 1cm5A
1r9dA Glycerol bound form of the b12-independent glycerol dehydratase from clostridium butyricum (see paper)
29% identity, 74% coverage: 191:755/760 of query aligns to 196:782/786 of 1r9dA
Sites not aligning to the query:
2f3oA Crystal structure of a glycyl radical enzyme from archaeoglobus fulgidus (see paper)
24% identity, 87% coverage: 93:754/760 of query aligns to 57:768/773 of 2f3oA
6vxeA Crystal structure of hydroxyproline dehydratase (hypd) from clostridioides difficile with substrate trans-4-hydroxy-l-proline bound (see paper)
23% identity, 87% coverage: 93:755/760 of query aligns to 65:785/789 of 6vxeA
A0A031WDE4 Trans-4-hydroxy-L-proline dehydratase; Glycyl radical enzyme; Hyp dehydratase; EC 4.2.1.172 from Clostridioides difficile (Peptoclostridium difficile) (see paper)
23% identity, 87% coverage: 93:755/760 of query aligns to 65:785/789 of A0A031WDE4
7vuaA Anaerobic hydroxyproline degradation involving c-n cleavage by a glycyl radical enzyme (see paper)
25% identity, 68% coverage: 248:760/760 of query aligns to 248:785/785 of 7vuaA
E5Y7I4 (2S)-3-sulfopropanediol sulfolyase; (S)-DHPS sulfolyase; EC 4.4.1.41 from Bilophila wadsworthia (strain 3_1_6) (see paper)
24% identity, 67% coverage: 248:755/760 of query aligns to 280:819/824 of E5Y7I4
Sites not aligning to the query:
6lonA Crystal structure of hpsg (see paper)
24% identity, 67% coverage: 248:755/760 of query aligns to 260:799/804 of 6lonA
Sites not aligning to the query:
6nd3A Wild-type choline tma lyase in complex with betaine aldehyde (see paper)
22% identity, 67% coverage: 250:760/760 of query aligns to 260:795/795 of 6nd3A
Sites not aligning to the query:
6vueA Wild-type choline tma lyase in complex with 1-methyl-1,2,3,6- tetrahydropyridin-3-ol (see paper)
22% identity, 67% coverage: 250:760/760 of query aligns to 268:803/803 of 6vueA
Sites not aligning to the query:
5fawB T502a mutant of choline tma-lyase (see paper)
22% identity, 67% coverage: 250:760/760 of query aligns to 271:806/806 of 5fawB
Sites not aligning to the query:
Q30W70 Choline trimethylamine-lyase; Choline TMA-lyase; Choline utilization protein C; Glycyl radical enzyme CutC; GRE CutC; EC 4.3.99.4 from Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20) (Desulfovibrio alaskensis) (see 2 papers)
22% identity, 67% coverage: 250:760/760 of query aligns to 311:846/846 of Q30W70
Sites not aligning to the query:
P68066 Autonomous glycyl radical cofactor from Escherichia coli (strain K12) (see paper)
83% identity, 8% coverage: 701:760/760 of query aligns to 68:127/127 of P68066
Sites not aligning to the query:
7e7lA The crystal structure of arylacetate decarboxylase from olsenella scatoligenes.
23% identity, 67% coverage: 248:755/760 of query aligns to 231:767/770 of 7e7lA
Sites not aligning to the query:
7kq3A Structure of isethionate sulfite-lyase from bilophila wadsworthia with substrate isethionate bound (see paper)
25% identity, 69% coverage: 232:755/760 of query aligns to 265:820/825 of 7kq3A
Sites not aligning to the query:
5ymrB The crystal structure of iseg (see paper)
23% identity, 69% coverage: 233:755/760 of query aligns to 239:793/798 of 5ymrB
Sites not aligning to the query:
Q727N1 Isethionate sulfite-lyase; C-S lyase IseG; Glycyl radical enzyme IseG; GRE IseG; EC 4.4.1.38 from Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) (see paper)
23% identity, 69% coverage: 233:755/760 of query aligns to 269:823/828 of Q727N1
Sites not aligning to the query:
5a0uH Structure of cutc choline lyase choline bound form from klebsiella pneumoniae. (see paper)
29% identity, 30% coverage: 527:755/760 of query aligns to 558:790/795 of 5a0uH
Sites not aligning to the query:
>202036 FitnessBrowser__MR1:202036
MTDKTELFANAWEGFTPGDWKSEVNVRDFIQQNYAPYEGDESFLAGATDATTQLWDKVME
GIKQENRTHAPVDFDTKMVSTITSHDAGYINKDLETIVGLQTDAPLKRAMLPNGGIRMVE
SSCAAYDRVLDEDVKYIYSELRKTHNQGVFDVYTPEIMACRKSGVLTGLPDAYGRGRIIG
DYRRVALYGIDFLMKDKFAQFSSLQAQFEAGEDLSNVIQLREEIAEQHRALGQMKKMAAK
YGFDISRPASNAKEAIQWTYFGYLAAVKSQNGAAMSLGRTSSFLDIYIERDLKNGVITEQ
QAQEMIDHFVMKLRMVRFLRTPEYDELFSGDPIWATESIGGMGLDGRTLVTKSSFRFLNT
LYTMGPSPEPNITVLWSEKLPVGFKKYCAKVSIDTSSIQYENDDLMRPDFQSDDYAIACC
VSPMVVGKHMQFFGARANLAKTMLYAINGGVDEKLKIQIAPKADPITDKVLNFDDVMNRL
DGLMDWLATQYVTSLNAIHYMHDKYSYEAALMALHDRDVRRTMACGIAGLSIAADSLSAI
KYAQVKPVRDENGIAVDFEISGDYPKFGNNDPRVDDIACDLVERFMAKIRDRKMYRNAIP
TQSILTITSNVVYGKKTGNTPDGRRSGAPFAPGANPMHGRDEKGAIASLTSVAKLPFAHA
QDGISYTFSIVPNALGKDEDGRRTNLAALMDGYFAHNEGHEGGQHLNVNVMNREMLEDAV
VNPDKYPQLTIRVSGYAVRFNSLTPEQQQDVITRTFTKGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory