Comparing 202237 FitnessBrowser__MR1:202237 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
26% identity, 93% coverage: 15:395/408 of query aligns to 15:410/425 of O59010
2nwwA Crystal structure of gltph in complex with tboa (see paper)
27% identity, 93% coverage: 16:395/408 of query aligns to 11:401/407 of 2nwwA
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
26% identity, 93% coverage: 15:395/408 of query aligns to 7:402/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
26% identity, 93% coverage: 15:395/408 of query aligns to 7:402/408 of 6bauA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
27% identity, 96% coverage: 4:395/408 of query aligns to 6:407/413 of 6x14A
Sites not aligning to the query:
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
27% identity, 96% coverage: 4:395/408 of query aligns to 9:410/419 of 6x15A
Sites not aligning to the query:
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
27% identity, 95% coverage: 16:404/408 of query aligns to 11:412/416 of 6r7rA
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
28% identity, 74% coverage: 15:317/408 of query aligns to 7:322/396 of 6bmiA
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
27% identity, 95% coverage: 16:404/408 of query aligns to 16:421/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
27% identity, 95% coverage: 16:404/408 of query aligns to 15:420/424 of 6zl4A
Sites not aligning to the query:
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
27% identity, 95% coverage: 16:404/408 of query aligns to 18:423/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
27% identity, 95% coverage: 16:404/408 of query aligns to 18:423/427 of 5e9sA
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
28% identity, 59% coverage: 146:386/408 of query aligns to 204:445/503 of Q10901
Sites not aligning to the query:
7bcsA Asct2 in the presence of the inhibitor lc-bpe (position "down") in the outward-open conformation. (see paper)
27% identity, 63% coverage: 135:392/408 of query aligns to 172:431/442 of 7bcsA
7bcqA Asct2 in the presence of the inhibitor lc-bpe (position "up") in the outward-open conformation. (see paper)
27% identity, 63% coverage: 135:392/408 of query aligns to 172:431/442 of 7bcqA
Sites not aligning to the query:
6mpbB Cryo-em structure of the human neutral amino acid transporter asct2 (see paper)
27% identity, 63% coverage: 135:392/408 of query aligns to 176:435/446 of 6mpbB
Q15758 Neutral amino acid transporter B(0); ATB(0); Baboon M7 virus receptor; RD114/simian type D retrovirus receptor; Sodium-dependent neutral amino acid transporter type 2; Solute carrier family 1 member 5 from Homo sapiens (Human) (see 2 papers)
27% identity, 63% coverage: 138:392/408 of query aligns to 221:477/541 of Q15758
Sites not aligning to the query:
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
23% identity, 63% coverage: 121:378/408 of query aligns to 215:479/542 of P43003
Sites not aligning to the query:
7nsgA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with hip-b
23% identity, 71% coverage: 103:390/408 of query aligns to 127:409/430 of 7nsgA
Sites not aligning to the query:
6s3qA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with tfb-tboa
23% identity, 71% coverage: 103:390/408 of query aligns to 127:409/430 of 6s3qA
Sites not aligning to the query:
>202237 FitnessBrowser__MR1:202237
MKQESSFLAKLANGSLVLQILVGIIAGVALASFSHEWAKQVAFLGSLFVGALKAIAPILV
FILVASSIANQKKNTQTNMRPIVVLYLLGTFAAALTAVILSMMFPTTLVLAAGVEGTSPP
QGISEVISTLLFKLVDNPVNALMTGNYIGILAWGVGLGLALHHSSDSTKQVFADVSHGIS
QMVHFIIRLAPIGIFGLVAATFAETGFAAIAGYAQLLAVLLGAMAFIALIINPLIVYVKI
KRNPYPLVIRCLRESGMTAFFTRSSAANIPVNMALCEKLKLHEDTYAVSIPLGATINMGG
AAITITVLTLAAAHTLGIQVDLLTALLLSVVAAISACGASGVAGGSLLLIPLACSLFGIS
NDVAMQVVAVGFIIGVIQDAAETALNSSTDVIFTAAACEAAENKAKLG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory