SitesBLAST
Comparing 202283 FitnessBrowser__MR1:202283 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9R1J0 Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating; EC 1.1.1.170 from Mus musculus (Mouse) (see 3 papers)
26% identity, 81% coverage: 10:260/309 of query aligns to 33:292/362 of Q9R1J0
- V53 (≠ K34) to D: in bpa; does not rescue the yeast mutant lacking the ortholog erg26
- A94 (= A66) to T: in bpa; does not rescue the yeast mutant lacking the ortholog erg26
- P98 (≠ T75) to L: in str; does not rescue the yeast mutant lacking the ortholog erg26
- V109 (= V86) to M: in str; rescues the yeast mutant lacking the ortholog erg26
Sites not aligning to the query:
- 103:362 natural variant: Missing (in bpa)
- 359:362 Prevents secretion from ER
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
25% identity, 97% coverage: 6:304/309 of query aligns to 3:304/313 of 6bwlA
- active site: T122 (= T111), C123 (≠ I112), M124 (≠ K113), Y147 (= Y137), K151 (= K141)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D31 (≠ T33), N32 (≠ K34), L33 (≠ P35), N35 (≠ R37), S36 (≠ D38), D57 (vs. gap), I58 (vs. gap), L79 (≠ C65), A80 (= A66), A81 (= A67), I83 (≠ A69), M120 (≠ I109), K151 (= K141), N176 (≠ L166), T177 (≠ V167)
- binding uridine-5'-diphosphate: N176 (≠ L166), G189 (vs. gap), V190 (vs. gap), N205 (≠ P190), I206 (vs. gap), Y207 (≠ F191), Q212 (≠ N196), R214 (= R198), I250 (≠ T234), E275 (≠ I271)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
25% identity, 97% coverage: 5:303/309 of query aligns to 2:298/309 of 4zrnA
- active site: T117 (= T111), G119 (≠ A118), A120 (≠ T119), Y143 (= Y137), K147 (= K141), Y181 (vs. gap), G185 (≠ N171)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D31 (= D26), N32 (≠ T27), S34 (≠ V29), S35 (≠ F30), G36 (= G31), S51 (≠ L46), I52 (≠ T47), L73 (≠ C65), A74 (= A66), A75 (= A67), T92 (≠ V86), S115 (≠ I109), S116 (= S110), Y143 (= Y137), K147 (= K141), Y170 (≠ P164), V173 (= V167)
- binding uridine-5'-diphosphate-glucose: T117 (= T111), G119 (≠ A118), A120 (≠ T119), Y143 (= Y137), N172 (≠ L166), G185 (≠ N171), V186 (= V172), H201 (≠ N186), F203 (= F191), Y208 (≠ N196), R210 (= R198), V244 (≠ T234), R267 (≠ M256), D270 (≠ K264)
Q9FX01 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1; At3BETAHSD/D1; 4alpha-carboxysterol-C3-dehydrogenase/C4-decarboxylase isoform 1-1; Reticulon-like protein B24; AtRTNLB24; Sterol-4-alpha-carboxylate 3-dehydrogenase 1, decarboxylating; EC 1.1.1.418 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
22% identity, 91% coverage: 25:304/309 of query aligns to 52:353/439 of Q9FX01
- D72 (≠ E45) Essential for the 3betaHSD/D activity; mutation D->A,V: Lost activity.
- T131 (≠ I109) Essential for the 3betaHSD/D activity; mutation to V: Lost activity.
- S133 (≠ T111) mutation to A: Reduced activity with slower catalysis and lower substrate binding.
- S135 (≠ K113) mutation to A: Normal activity, but slower catalysis with 4alpha-carboxysterol as substrate.; mutation to T: Altered activity due to reduced affinity and catalysis and leading to lower amount of C4-demethylated sterols and higher quantities of 4,4-dimethylated sterol intermediates, and a higher ratio of 4,4-dimethylsterols to 4alpha-methylsterols.; mutation to Y: Altered activity leading to an exclusive production of C4-methylated sterols and 4alpha-carboxy-3beta-hydroxy sterols.
- Y161 (= Y137) Essential for the 3betaHSD/D activity; mutation to F: Lost activity.
- K165 (= K141) Essential for the 3betaHSD/D activity; mutation to I: Lost activity.
- R320 (vs. gap) mutation to I: Normal activity.
- R328 (≠ L279) Essential for the 3betaHSD/D activity; mutation to I: Lost activity.
Sites not aligning to the query:
- 41 Essential for the 3betaHSD/D activity; D→V: Lost activity.
Q9LPG6 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2; NDP-rhamnose synthase; Protein MUCILAGE-MODIFIED 4; Protein RHAMNOSE BIOSYNTHESIS 2; Rhamnose biosynthetic enzyme 2; AtRHM2; UDP-L-rhamnose synthase MUM4; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
24% identity, 80% coverage: 4:250/309 of query aligns to 9:276/667 of Q9LPG6
- G18 (= G13) mutation to A: Abolishes dehydratase activity.
- K36 (vs. gap) mutation to A: Reduces dehydratase activity.
- D96 (≠ M72) mutation to N: In mum4-1; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
- K165 (= K141) mutation to A: Abolishes dehydratase activity.
- G193 (= G169) mutation to R: In mum4-2; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
Sites not aligning to the query:
- 392 G→A: No effect on dehydratase activity.
- 413 K→A: No effect on dehydratase activity.
- 518 K→A: No effect on dehydratase activity.
Q9SYM5 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1; Protein REPRESSOR OF LRX1 1; Rhamnose biosynthetic enzyme 1; AtRHM1; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
29% identity, 54% coverage: 4:171/309 of query aligns to 7:193/669 of Q9SYM5
Sites not aligning to the query:
- 283 R→K: In rol1-2; Abolishes dehydratase activity in vitro (PubMed:16766693). Induces aberrant accumulation of flavonols leading to alterations in plant growth and cell shape formation (PubMed:18567791, PubMed:18757557).
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
26% identity, 78% coverage: 6:247/309 of query aligns to 3:263/321 of 6zllA
- active site: T126 (= T111), S127 (≠ I112), S128 (≠ K113), Y149 (= Y137), K153 (= K141)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D32 (vs. gap), H33 (vs. gap), F34 (= F30), I35 (≠ G31), K43 (vs. gap), D62 (≠ L46), I63 (≠ T47), L81 (≠ C65), A82 (= A66), A83 (= A67), I124 (= I109), T126 (= T111), Y149 (= Y137), K153 (= K141), Y176 (≠ P164), V179 (= V167), R185 (≠ K173), M188 (vs. gap)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (≠ A69), V87 (= V71), R88 (≠ M72), T126 (= T111), S127 (≠ I112), Y149 (= Y137), T178 (≠ L166), R185 (≠ K173), A189 (vs. gap), R192 (≠ T178), T204 (≠ P190), F206 (= F191), Q211 (≠ N196), R213 (= R198), I250 (≠ T234)
Sites not aligning to the query:
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: 276
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
26% identity, 78% coverage: 6:247/309 of query aligns to 3:263/314 of 6zldA
- active site: T126 (= T111), S127 (≠ I112), S128 (≠ K113), Y149 (= Y137), K153 (= K141)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D32 (vs. gap), H33 (vs. gap), F34 (= F30), I35 (≠ G31), K43 (vs. gap), D62 (≠ L46), I63 (≠ T47), L81 (≠ C65), A82 (= A66), A83 (= A67), I124 (= I109), T126 (= T111), K153 (= K141), Y176 (≠ P164), T178 (≠ L166), R185 (≠ K173), M188 (vs. gap)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (≠ A69), R88 (≠ M72), T126 (= T111), S127 (≠ I112), S128 (≠ K113), Y149 (= Y137), F177 (≠ P165), T178 (≠ L166), R185 (≠ K173), M188 (vs. gap), A189 (vs. gap), R192 (≠ T178), T204 (≠ P190), F206 (= F191), Q211 (≠ N196), R213 (= R198), I250 (≠ T234)
Sites not aligning to the query:
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
26% identity, 78% coverage: 6:247/309 of query aligns to 3:263/314 of 6zl6A
- active site: T126 (= T111), S127 (≠ I112), S128 (≠ K113), Y149 (= Y137), K153 (= K141)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D32 (vs. gap), H33 (vs. gap), F34 (= F30), I35 (≠ G31), K43 (vs. gap), D62 (≠ L46), I63 (≠ T47), L81 (≠ C65), A82 (= A66), A83 (= A67), I124 (= I109), T126 (= T111), K153 (= K141), Y176 (≠ P164), T178 (≠ L166), V179 (= V167), R185 (≠ K173), M188 (vs. gap)
- binding uridine-5'-diphosphate: T178 (≠ L166), A189 (vs. gap), R192 (≠ T178), T204 (≠ P190), F206 (= F191), Q211 (≠ N196), R213 (= R198), I250 (≠ T234)
Sites not aligning to the query:
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
25% identity, 78% coverage: 6:247/309 of query aligns to 3:263/314 of 6zljA
- active site: T126 (= T111), S127 (≠ I112), S128 (≠ K113), F149 (≠ Y137), K153 (= K141)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D32 (vs. gap), H33 (vs. gap), F34 (= F30), I35 (≠ G31), K43 (vs. gap), D62 (≠ L46), I63 (≠ T47), L81 (≠ C65), A82 (= A66), A83 (= A67), I124 (= I109), T126 (= T111), K153 (= K141), Y176 (≠ P164), T178 (≠ L166), V179 (= V167), R185 (≠ K173), M188 (vs. gap)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (≠ A69), R88 (≠ M72), T126 (= T111), S127 (≠ I112), S128 (≠ K113), F149 (≠ Y137), F177 (≠ P165), T178 (≠ L166), R185 (≠ K173), M188 (vs. gap), A189 (vs. gap), R192 (≠ T178), T204 (≠ P190), F206 (= F191), Q211 (≠ N196), R213 (= R198), I250 (≠ T234)
Sites not aligning to the query:
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: 276
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
25% identity, 97% coverage: 6:304/309 of query aligns to 3:306/322 of 1r66A
- active site: T127 (= T111), D128 (≠ I112), E129 (≠ K113), Y151 (= Y137), K155 (= K141)
- binding nicotinamide-adenine-dinucleotide: G10 (= G13), F11 (= F14), I12 (≠ V15), D37 (vs. gap), S38 (vs. gap), L39 (vs. gap), T40 (= T27), G43 (≠ F30), D63 (≠ E45), I64 (≠ L46), F83 (≠ C65), A84 (= A66), A85 (= A67), S87 (≠ A69), T102 (≠ V86), V125 (≠ I109), S126 (= S110), Y151 (= Y137), K155 (= K141), N181 (≠ V167)
- binding thymidine-5'-diphosphate: H88 (= H70), E129 (≠ K113), N180 (≠ L166), K190 (vs. gap), L191 (vs. gap), P206 (= P188), Y208 (≠ F191), R215 (= R198), N250 (≠ T234), R274 (= R274), H277 (≠ G277)
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
27% identity, 78% coverage: 6:246/309 of query aligns to 3:262/322 of 1r6dA
- active site: T127 (= T111), N128 (≠ I112), Q129 (≠ K113), Y151 (= Y137), K155 (= K141)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (≠ A69), H88 (= H70), T127 (= T111), N128 (≠ I112), Q129 (≠ K113), Y151 (= Y137), N180 (≠ L166), K190 (vs. gap), L191 (vs. gap), P206 (= P188), Y208 (≠ F191), R215 (= R198), N250 (≠ T234)
- binding nicotinamide-adenine-dinucleotide: G10 (= G13), F11 (= F14), I12 (≠ V15), D37 (vs. gap), S38 (vs. gap), L39 (vs. gap), T40 (= T27), A42 (≠ V29), G43 (≠ F30), D63 (≠ E45), I64 (≠ L46), F83 (≠ C65), A84 (= A66), A85 (= A67), S87 (≠ A69), T102 (≠ V86), V125 (≠ I109), S126 (= S110), Y151 (= Y137), K155 (= K141), N181 (≠ V167)
Sites not aligning to the query:
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
27% identity, 70% coverage: 4:220/309 of query aligns to 1:233/307 of 6wjaA
- active site: A118 (≠ T111), A119 (≠ I112), A120 (≠ K113), F143 (≠ Y137), K147 (= K141)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D31 (= D26), D32 (≠ T27), S34 (≠ V29), T35 (≠ F30), G36 (= G31), A55 (≠ L46), L74 (≠ C65), A75 (= A66), A76 (= A67), S93 (≠ V86), F143 (≠ Y137), K147 (= K141), F170 (≠ P164), F171 (≠ P165), I173 (≠ V167)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (= V71), A120 (≠ K113), N172 (≠ L166), G186 (≠ T178), V187 (≠ M179), F191 (vs. gap), T202 (≠ P190), F204 (= F191), R211 (= R198)
Sites not aligning to the query:
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
27% identity, 70% coverage: 4:220/309 of query aligns to 2:234/308 of 6wj9B
- active site: A119 (≠ T111), A120 (≠ I112), A121 (≠ K113), F144 (≠ Y137), K148 (= K141)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), F12 (= F14), I13 (≠ V15), D32 (= D26), D33 (≠ T27), S35 (≠ V29), T36 (≠ F30), G37 (= G31), D55 (≠ E45), A56 (≠ L46), L75 (≠ C65), A76 (= A66), A77 (= A67), S94 (≠ V86), A117 (≠ I109), A119 (≠ T111), F144 (≠ Y137), K148 (= K141), F171 (≠ P164), F172 (≠ P165), I174 (≠ V167)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (= V71), N173 (≠ L166), G187 (≠ T178), V188 (≠ M179), F192 (vs. gap), T203 (≠ P190), L204 (vs. gap), F205 (= F191), R212 (= R198)
Sites not aligning to the query:
2hunA Crystal structure of hypothetical protein ph0414 from pyrococcus horikoshii ot3
21% identity, 98% coverage: 3:305/309 of query aligns to 1:302/329 of 2hunA
- active site: T125 (= T111), D126 (≠ I112), E127 (≠ K113), Y149 (= Y137), K153 (= K141)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), F12 (= F14), I13 (≠ V15), D34 (= D26), K35 (≠ T27), S40 (≠ T33), D60 (≠ E45), V61 (≠ L46), L80 (≠ C65), A81 (= A66), A82 (= A67), S99 (≠ V86), T125 (= T111), K153 (= K141), C176 (≠ P164), T177 (≠ P165), N178 (≠ L166), N179 (≠ V167)
3eheA Crystal structure of udp-glucose 4 epimerase (gale-1) from archaeoglobus fulgidus
24% identity, 80% coverage: 6:251/309 of query aligns to 2:251/290 of 3eheA
- active site: T111 (= T111), S112 (≠ I112), T113 (≠ K113), Y135 (= Y137), K139 (= K141)
- binding nicotinamide-adenine-dinucleotide: G6 (= G10), G9 (= G13), F10 (= F14), I11 (≠ V15), D29 (≠ T33), N30 (≠ K34), L31 (≠ P35), S32 (≠ A36), S33 (≠ R37), G34 (≠ D38), D49 (vs. gap), L50 (vs. gap), I68 (≠ C65), A69 (= A66), A70 (= A67), T109 (≠ I109), Y135 (= Y137), K139 (= K141), F162 (≠ P164), A163 (≠ P165), N164 (≠ L166), V165 (= V167)
6jkhA The NAD+-bound form of human nsdhl (see paper)
30% identity, 44% coverage: 10:145/309 of query aligns to 9:131/212 of 6jkhA
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), F13 (= F14), L14 (≠ V15), D33 (vs. gap), I34 (vs. gap), G48 (= G44), L50 (= L46), A70 (= A66), S71 (≠ A67), Y123 (= Y137), K127 (= K141)
2c59A Gdp-mannose-3', 5' -epimerase (arabidopsis thaliana), with gdp-alpha- d-mannose and gdp-beta-l-galactose bound in the active site. (see paper)
23% identity, 96% coverage: 6:303/309 of query aligns to 19:319/364 of 2c59A
- active site: S132 (≠ T111), A133 (≠ I112), C134 (≠ K113), Y163 (= Y137), K167 (= K141), K206 (≠ N171)
- binding guanosine-5'-diphosphate-beta-l-galactose: M91 (≠ A69), G92 (≠ H70), G93 (≠ V71), M94 (= M72), S132 (≠ T111), C134 (≠ K113), H191 (≠ P165), N192 (≠ L166), K206 (≠ N171), A207 (≠ V172), A210 (≠ N175), F211 (= F176), K214 (≠ M179), W225 (≠ F191), Q230 (≠ N196), R232 (= R198), M266 (≠ T234), P289 (≠ N268), E290 (≠ Q269)
- binding guanosine-5'-diphosphate-alpha-d-mannose: G92 (≠ H70), M94 (= M72), I97 (vs. gap), S132 (≠ T111), C134 (≠ K113), Y163 (= Y137), N192 (≠ L166), K206 (≠ N171), A207 (≠ V172), A210 (≠ N175), F211 (= F176), K214 (≠ M179), W225 (≠ F191), Q230 (≠ N196), R232 (= R198), M266 (≠ T234), P289 (≠ N268), E290 (≠ Q269), R295 (= R274)
- binding nicotinamide-adenine-dinucleotide: G23 (= G10), G26 (= G13), F27 (= F14), I28 (≠ V15), D47 (≠ K34), W48 (≠ P35), K49 (≠ A36), D67 (≠ E45), L68 (= L46), L87 (≠ C65), A89 (= A67), M91 (≠ A69), I111 (≠ V90), A130 (≠ I109), S132 (≠ T111), Y163 (= Y137), K167 (= K141), F190 (≠ P164), N192 (≠ L166), I193 (≠ V167), K206 (≠ N171)
Sites not aligning to the query:
Q93VR3 GDP-mannose 3,5-epimerase; GDP-Man 3,5-epimerase; EC 5.1.3.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
23% identity, 96% coverage: 6:303/309 of query aligns to 30:330/377 of Q93VR3
- 34:60 (vs. 10:36, 26% identical) binding
- D58 (≠ K34) binding
- D78 (≠ E45) binding
- C145 (≠ K113) mutation to A: Loss of activity.; mutation to S: Strong reduction of activity.
- Y174 (= Y137) binding ; mutation to F: Loss of activity.
- K178 (= K141) binding ; mutation to R: Strong reduction of activity.
- K217 (≠ N171) mutation to A: Loss of activity.
- R306 (= R274) mutation to A: Strong reduction of activity.
Q9SA77 UDP-arabinose 4-epimerase 1; UDP-D-xylose 4-epimerase 1; EC 5.1.3.5 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 34% coverage: 60:163/309 of query aligns to 147:246/419 of Q9SA77
Sites not aligning to the query:
- 275 G→D: In mur4-1; 50% reduction in L-Ara in cell wall material.
- 304 R→Q: In mur4-3; 50% reduction in L-Ara in cell wall material.
Query Sequence
>202283 FitnessBrowser__MR1:202283
MPTQSILLTGATGFVGQQILRQLPQDTRVFGRTKPARDCHFFAGELTANTDYRSALSGVD
VVIHCAARAHVMNETANNAAQLYQEVNTLVTLALAEQAAAAGVKRFIFISTIKVNGEATI
AGQLFRASDARQPLDHYGESKAKAEIGLFDIARKTEIEVVIIRPPLVYGPNVKANFATML
NLAKKNLPLPFGAIHNKRSMVALDNLVDLIVTCIEHPNAANQIFLVSDDQDVSTTELLKL
MTGAAGKKPRLLPVPMAWLILAGKVTGNQAIIDRLCGNLQVDITHTKNTLSWQPPITVEE
GVRRCFVKE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory