Comparing 207344 MicrobesOnline__882:207344 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
5vyeB Crystal structure of l-threonine aldolase from pseudomonas putida
46% identity, 99% coverage: 3:339/340 of query aligns to 4:341/344 of 5vyeB
O50584 Low specificity L-threonine aldolase; Low specificity L-TA; EC 4.1.2.48 from Pseudomonas sp. (strain NCIMB 10558) (see paper)
45% identity, 99% coverage: 3:337/340 of query aligns to 6:341/346 of O50584
1v72A Crystal structure of phenylserine aldolase from pseudomonas putida
41% identity, 98% coverage: 5:337/340 of query aligns to 7:342/345 of 1v72A
1jg8D Crystal structure of threonine aldolase (low-specificity)
24% identity, 86% coverage: 1:291/340 of query aligns to 1:286/344 of 1jg8D
Sites not aligning to the query:
1lw5B X-ray structure of l-threonine aldolase (low-specificity) in complex with glycine (see paper)
24% identity, 84% coverage: 7:291/340 of query aligns to 6:285/343 of 1lw5B
Sites not aligning to the query:
1lw4B X-ray structure of l-threonine aldolase (low-specificity) in complex with l-allo-threonine (see paper)
24% identity, 84% coverage: 7:291/340 of query aligns to 6:285/343 of 1lw4B
Sites not aligning to the query:
3wlxA Crystal structure of low-specificity l-threonine aldolase from escherichia coli
25% identity, 93% coverage: 17:331/340 of query aligns to 16:322/331 of 3wlxA
Sites not aligning to the query:
O07051 L-allo-threonine aldolase; L-allo-TA; L-allo-threonine acetaldehyde-lyase; EC 4.1.2.49 from Aeromonas jandaei (see paper)
24% identity, 99% coverage: 1:335/340 of query aligns to 22:331/338 of O07051
4rjyA Crystal structure of e. Coli l-threonine aldolase in complex with a non-covalently uncleaved bound l-serine substrate (see paper)
24% identity, 93% coverage: 17:331/340 of query aligns to 16:322/332 of 4rjyA
4lnlA Structure of escherichia coli threonine aldolase in complex with allo- thr (see paper)
24% identity, 93% coverage: 17:331/340 of query aligns to 16:322/332 of 4lnlA
Sites not aligning to the query:
4lnjA Structure of escherichia coli threonine aldolase in unliganded form (see paper)
24% identity, 93% coverage: 17:331/340 of query aligns to 16:322/332 of 4lnjA
Sites not aligning to the query:
3wgcB Aeromonas jandaei l-allo-threonine aldolase h128y/s292r double mutant (see paper)
24% identity, 99% coverage: 1:335/340 of query aligns to 21:328/333 of 3wgcB
Sites not aligning to the query:
4lnmA Structure of escherichia coli threonine aldolase in complex with serine (see paper)
24% identity, 93% coverage: 17:331/340 of query aligns to 16:322/331 of 4lnmA
Sites not aligning to the query:
3wgbD Crystal structure of aeromonas jandaei l-allo-threonine aldolase (see paper)
27% identity, 53% coverage: 1:180/340 of query aligns to 20:174/324 of 3wgbD
Sites not aligning to the query:
Q8RXU4 Low-specificity L-threonine aldolase 1; Threonine aldolase 1; EC 4.1.2.48 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
25% identity, 78% coverage: 33:297/340 of query aligns to 35:306/358 of Q8RXU4
>207344 MicrobesOnline__882:207344
MLKSFASDNTAGVHPRILAAMASANEGHAKAYGMDPWTSEAADVFRGHFGDDIDLYFVFL
GTAANVLGLKSVTRPWHSVVCADVAHINVDECGAPESVTGSKLQVIPSHDGRIRVMDIVP
LMHSLGNFHHSQPRVISITQTTELGTVYSPAQIRALADFAHANGMLLHMDGARLCNAAAA
LDTGLAALTRDTGVDVLSFGGTKNGMMFGEAVIFFNRELASEFKFIRKQGMQLVSKMRFI
AAQFIELLRDGLWLENARNANSMARLMAESLRGLPHVTITRPVEANAVFARLSPEHIAAL
QKDFYFYEWDPVLHEVRWMTSFDSTEEQVMEFVHAIKRLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory