SitesBLAST
Comparing 207685 MicrobesOnline__882:207685 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q46856 Alcohol dehydrogenase YqhD; EC 1.1.1.2 from Escherichia coli (strain K12) (see paper)
53% identity, 100% coverage: 1:384/385 of query aligns to 1:386/387 of Q46856
- GGS 38:40 (= GGS 38:40) binding
- 93:99 (vs. 93:99, 86% identical) binding
- T138 (= T138) binding
- N147 (= N147) binding
- K160 (= K158) binding
- YTYT 179:182 (≠ LTYT 177:180) binding
- D194 (= D192) binding
- H198 (= H196) binding
- H267 (= H265) binding
- H281 (= H279) binding
1oj7B Structural genomics, unknown function crystal structure of e. Coli k- 12 yqhd (see paper)
53% identity, 99% coverage: 4:384/385 of query aligns to 7:389/390 of 1oj7B
- binding 5,6-dihydroxy-nadp: G41 (= G38), S43 (= S40), P70 (≠ A67), N71 (= N68), G97 (= G94), G98 (= G95), S99 (= S96), D102 (= D99), T141 (= T138), L142 (= L139), T145 (= T142), S147 (= S144), G152 (= G149), V154 (= V151), K163 (= K158), T185 (= T180), L186 (= L181), P187 (= P182), Q190 (= Q185), H201 (= H196), H270 (= H265), H284 (= H279)
- binding zinc ion: D197 (= D192), H201 (= H196), H270 (= H265), H284 (= H279)
1oj7A Structural genomics, unknown function crystal structure of e. Coli k- 12 yqhd (see paper)
53% identity, 99% coverage: 4:384/385 of query aligns to 7:389/390 of 1oj7A
- binding 5,6-dihydroxy-nadp: G41 (= G38), S43 (= S40), P70 (≠ A67), N71 (= N68), G97 (= G94), G98 (= G95), S99 (= S96), D102 (= D99), T141 (= T138), L142 (= L139), T145 (= T142), S147 (= S144), N150 (= N147), G152 (= G149), K163 (= K158), T185 (= T180), L186 (= L181), Q190 (= Q185), D197 (= D192), H201 (= H196), H270 (= H265), H284 (= H279)
7w9zA Crystal structure of bacillus subtilis yugj in complex with NADP and nitrate (see paper)
38% identity, 100% coverage: 2:385/385 of query aligns to 1:381/381 of 7w9zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G37 (= G37), G38 (= G38), S40 (= S40), P69 (≠ A67), G96 (= G94), G97 (= G95), S98 (= S96), D101 (= D99), T137 (= T138), L138 (= L139), T141 (= T142), N146 (= N147), G148 (= G149), K159 (vs. gap), T181 (= T180), V182 (≠ L181), P183 (= P182), H186 (≠ Q185)
- binding nitrate ion: R72 (≠ Q70), V73 (≠ F71), S74 (≠ T72), V150 (= V151), N153 (≠ H154), W154 (≠ G155), E155 (≠ N156), W263 (= W262), H270 (= H269), H280 (= H279)
7w9yA Crystal structure of bacillus subtilis yugj in complex with NADP and nickel (see paper)
38% identity, 100% coverage: 1:385/385 of query aligns to 3:389/389 of 7w9yA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G40 (= G37), G41 (= G38), S43 (= S40), P72 (≠ A67), N73 (= N68), G99 (= G94), G100 (= G95), S101 (= S96), T140 (= T138), L141 (= L139), T144 (= T142), K162 (vs. gap), T184 (= T180), V185 (≠ L181), P186 (= P182), H189 (≠ Q185), H283 (= H279)
8i29A Crystal structure of butanol dehydrogenase a (yqdh) in complex with nadh from fusobacterium nucleatum
34% identity, 90% coverage: 4:351/385 of query aligns to 3:351/384 of 8i29A
- binding cobalt (ii) ion: E205 (= E199), H271 (= H265), H285 (= H279)
- binding nicotinamide-adenine-dinucleotide: A102 (≠ G95), T142 (= T138), I143 (≠ L139), A146 (≠ T142), S148 (= S144), S151 (≠ N147), S153 (≠ G149), I155 (≠ V151), T186 (= T180), I187 (≠ L181), L191 (≠ Q185)
7fjgA Crystal structure of butanol dehydrogenase a (yqdh) in complex with partial nadh from fusobacterium nucleatum
34% identity, 90% coverage: 4:351/385 of query aligns to 3:351/384 of 7fjgA
1vljB Crystal structure of nadh-dependent butanol dehydrogenase a (tm0820) from thermotoga maritima at 1.78 a resolution
35% identity, 100% coverage: 1:384/385 of query aligns to 6:398/400 of 1vljB
- binding fe (iii) ion: D200 (= D192), H204 (= H196), H273 (= H265), H287 (= H279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G45 (= G38), S47 (= S40), P76 (≠ A67), G103 (= G94), G104 (= G95), S105 (= S96), D108 (= D99), T144 (= T138), I145 (≠ L139), T148 (= T142), T150 (≠ S144), N153 (= N147), N155 (≠ G149), K166 (vs. gap), T188 (= T180), L189 (= L181), Q193 (= Q185), H204 (= H196), H287 (= H279)
1o2dA Crystal structure of alcohol dehydrogenase, iron-containing (tm0920) from thermotoga maritima at 1.30 a resolution (see paper)
28% identity, 78% coverage: 4:302/385 of query aligns to 2:293/359 of 1o2dA
- binding fe (iii) ion: D189 (= D192), H193 (= H196), H256 (= H265), H270 (= H279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S38 (≠ G39), S39 (= S40), E68 (≠ A67), N69 (= N68), G95 (= G94), G96 (= G95), S97 (= S96), D100 (= D99), T136 (= T138), T137 (≠ L139), T140 (= T142), S142 (= S144), Y147 (≠ G149), I149 (≠ V151), K157 (≠ G157), S177 (≠ T180), M178 (≠ L181), L182 (≠ Q185), D189 (= D192), H193 (= H196), H270 (= H279)
A0A0S1X9S7 Alcohol dehydrogenase; EC 1.1.1.1 from Thermococcus barophilus (see paper)
30% identity, 92% coverage: 10:363/385 of query aligns to 8:351/378 of A0A0S1X9S7
- D195 (= D192) mutation to A: Disrupts the overall structure of the enzyme. Lack of acetaldehyde reduction activity and displays weak ethanol oxidation activity.
- H199 (= H196) mutation to A: Disrupts the overall structure of the enzyme. Retains 10% of ethanol oxidation and acetaldehyde reduction activities.
- H262 (= H265) mutation to A: Disrupts the overall structure of the enzyme. Displays weak ethanol oxidation and acetaldehyde reduction activities.
- H266 (= H269) mutation to A: Disrupts the overall structure of the enzyme. Displays higher acetaldehyde reduction activity (134%) but lower ethanol oxidation activity (36%).
- H274 (= H279) mutation to A: Disrupts the overall structure of the enzyme. Retains 20% of ethanol oxidation and acetaldehyde reduction activities.
1vhdA Crystal structure of an iron containing alcohol dehydrogenase (see paper)
28% identity, 78% coverage: 4:302/385 of query aligns to 3:294/361 of 1vhdA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S39 (≠ G39), S40 (= S40), E69 (≠ A67), N70 (= N68), G96 (= G94), G97 (= G95), S98 (= S96), D101 (= D99), T137 (= T138), T138 (≠ L139), T141 (= T142), S143 (= S144), T146 (≠ N147), Y148 (≠ G149), I150 (≠ V151), K158 (≠ G157), S178 (≠ T180), M179 (≠ L181), L183 (≠ Q185), D190 (= D192), H194 (= H196), H271 (= H279)
- binding zinc ion: D190 (= D192), H194 (= H196), H257 (= H265), H271 (= H279)
6c75B Structure of iron containing alcohol dehydrogenase from thermococcus thioreducens in a monoclinic crystal form (see paper)
30% identity, 93% coverage: 6:363/385 of query aligns to 2:350/378 of 6c75B
6c75A Structure of iron containing alcohol dehydrogenase from thermococcus thioreducens in a monoclinic crystal form (see paper)
30% identity, 93% coverage: 6:363/385 of query aligns to 2:350/378 of 6c75A
- binding fe (iii) ion: D193 (= D192), H197 (= H196), H260 (= H265), H272 (= H279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S33 (≠ G38), S35 (= S40), G91 (= G94), G92 (= G95), S93 (= S96), D96 (= D99), S139 (≠ A141), T140 (= T142), A143 (vs. gap), S148 (≠ N147), V152 (= V151), K159 (= K158), T181 (= T180), M182 (≠ L181), P183 (= P182), V186 (≠ Q185), F251 (vs. gap), H272 (= H279)
Q59104 4-hydroxybutyrate dehydrogenase; 4HbD; Gamma-hydroxybutyrate dehydrogenase; GHBDH; EC 1.1.1.61 from Cupriavidus necator (Alcaligenes eutrophus) (Ralstonia eutropha) (see paper)
29% identity, 85% coverage: 59:385/385 of query aligns to 58:382/382 of Q59104
- D193 (= D192) mutation to A: Retains very low activity.
- H197 (= H196) mutation to A: Loss of activity.
- H261 (≠ Q260) mutation to A: Loss of activity.
- H265 (≠ S264) mutation to A: 75% decrease in Vmax. Optimum pH is 9.5.; mutation to C: 95% decrease in Vmax. Optimum pH is 8.5.; mutation to D: Retains very low activity.; mutation to Y: Loss of activity.
- H280 (= H279) mutation to A: Retains very low activity.
6jkpA Crystal structure of sulfoacetaldehyde reductase from bifidobacterium kashiwanohense in complex with NAD+ (see paper)
26% identity, 83% coverage: 4:322/385 of query aligns to 4:316/376 of 6jkpA
- binding nicotinamide-adenine-dinucleotide: F42 (vs. gap), G96 (= G95), D100 (= D99), T137 (= T138), T138 (≠ L139), T141 (= T142), S143 (= S144), T146 (≠ N147), S181 (≠ T180), V182 (≠ L181), P183 (= P182)
6jkoA Crystal structure of sulfoacetaldehyde reductase from bifidobacterium kashiwanohense (see paper)
26% identity, 83% coverage: 4:322/385 of query aligns to 4:316/376 of 6jkoA
3zdrA Structure of the alcohol dehydrogenase (adh) domain of a bifunctional adhe dehydrogenase from geobacillus thermoglucosidasius ncimb 11955 (see paper)
24% identity, 92% coverage: 6:360/385 of query aligns to 5:372/403 of 3zdrA
3bfjA Crystal structure analysis of 1,3-propanediol oxidoreductase (see paper)
26% identity, 90% coverage: 4:351/385 of query aligns to 3:349/382 of 3bfjA
5yvmA Crystal structure of the archaeal halo-thermophilic red sea brine pool alcohol dehydrogenase adh/d1 bound to nzq (see paper)
26% identity, 98% coverage: 10:385/385 of query aligns to 13:403/403 of 5yvmA
- binding manganese (ii) ion: D207 (= D192), H211 (= H196), H276 (= H265), H291 (= H279)
- binding 5,6-dihydroxy-nadp: G41 (= G37), N44 (≠ S40), M45 (≠ A41), P73 (≠ A67), N74 (= N68), G100 (= G94), G101 (= G95), S102 (= S96), D105 (= D99), S151 (≠ T138), T152 (≠ L139), T155 (= T142), T160 (≠ N147), Y162 (≠ G149), V164 (= V151), K173 (= K158), E195 (≠ T180), L200 (≠ Q185), H211 (= H196), H276 (= H265), H280 (= H269), H291 (= H279)
5yvrA Crystal structure of the h277a mutant of adh/d1, an archaeal halo- thermophilic red sea brine pool alcohol dehydrogenase (see paper)
25% identity, 98% coverage: 10:385/385 of query aligns to 13:403/403 of 5yvrA
- binding manganese (ii) ion: D207 (= D192), H211 (= H196), H276 (= H265), H291 (= H279)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G41 (= G37), S43 (≠ G39), N44 (≠ S40), M45 (≠ A41), G100 (= G94), G101 (= G95), S102 (= S96), D105 (= D99), S151 (≠ T138), T152 (≠ L139), T155 (= T142), T160 (≠ N147), Y162 (≠ G149), V164 (= V151), K173 (= K158), E195 (≠ T180), M196 (≠ L181), L200 (≠ Q185), D207 (= D192), H211 (= H196), H291 (= H279)
Query Sequence
>207685 MicrobesOnline__882:207685
MYPFDFYNPTHIVFGKDRLPEIDRLVPKDARVLILYGGGSAKRFGTIDAVKKALGDRFVM
AFGGIEANPQFTTLMRAVALTRENDIDFLLAVGGGSVMDGTKFVALAHGYEGDEQGLLKH
GLNPIPIEKALPLGTVVTLPATGSEMNMGGVISHGNGKYPVLCAATFPRFSILDPTLTYT
LPAAQVANGVVDTFVHVMEQYLTFPAEGRFQDRTAEGILLTLTEVGYATLEDRADYDPRA
NLMWCATMALNGLIGAGVPQDWTSHMIGHEITALHGVDHGRTLAVILPAVMRVRREQKRE
KLLQYGRRVWGVTAKDENAAIDEAIARTEFFFESLGVPTRLSAYGIGEEAFDAIIAGLKE
KGHTAMSERGDLTLEDSRNILKAAL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory