Comparing 207819 MicrobesOnline__882:207819 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2rcyA Crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with NADP bound
31% identity, 98% coverage: 5:263/265 of query aligns to 7:260/262 of 2rcyA
5bshA Crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) in complex with l-proline (see paper)
32% identity, 98% coverage: 4:263/265 of query aligns to 10:271/272 of 5bshA
5bsgA Crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) in complex with NADP+ (see paper)
32% identity, 98% coverage: 4:263/265 of query aligns to 10:271/272 of 5bsgA
5bsfA Crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) in complex with NAD+ (see paper)
32% identity, 98% coverage: 4:263/265 of query aligns to 10:271/272 of 5bsfA
5bseA Crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) (see paper)
32% identity, 98% coverage: 4:263/265 of query aligns to 10:271/272 of 5bseA
2ag8A NADP complex of pyrroline-5-carboxylate reductase from neisseria meningitidis (see paper)
35% identity, 97% coverage: 8:265/265 of query aligns to 6:260/263 of 2ag8A
3triA Structure of a pyrroline-5-carboxylate reductase (proc) from coxiella burnetii (see paper)
31% identity, 99% coverage: 3:265/265 of query aligns to 3:269/272 of 3triA
Q96C36 Pyrroline-5-carboxylate reductase 2; P5C reductase 2; P5CR 2; EC 1.5.1.2 from Homo sapiens (Human) (see paper)
29% identity, 98% coverage: 4:264/265 of query aligns to 2:269/320 of Q96C36
Sites not aligning to the query:
6xp0A Structure of human pycr1 complexed with n-formyl l-proline (see paper)
29% identity, 98% coverage: 4:264/265 of query aligns to 4:268/272 of 6xp0A
2ahrE Crystal structures of 1-pyrroline-5-carboxylate reductase from human pathogen streptococcus pyogenes (see paper)
30% identity, 94% coverage: 5:253/265 of query aligns to 6:249/259 of 2ahrE
2amfA Crystal structure of 1-pyrroline-5-carboxylate reductase from human pathogen streptococcus pyogenes (see paper)
30% identity, 94% coverage: 5:253/265 of query aligns to 4:247/257 of 2amfA
5uatC Structure of human pycr-1 complexed with NADPH (see paper)
29% identity, 98% coverage: 4:264/265 of query aligns to 6:273/277 of 5uatC
2izzA Crystal structure of human pyrroline-5-carboxylate reductase
29% identity, 98% coverage: 4:264/265 of query aligns to 3:270/272 of 2izzA
5uauA Structure of human pycr-1 complexed with proline (see paper)
29% identity, 98% coverage: 4:264/265 of query aligns to 2:269/274 of 5uauA
6xp3A Structure of human pycr1 complexed with cyclopentanecarboxylic acid (see paper)
29% identity, 98% coverage: 4:264/265 of query aligns to 5:272/276 of 6xp3A
5uavA Structure of human pycr-1 complexed with NADPH and l-tetrahydrofuroic acid (see paper)
29% identity, 98% coverage: 4:264/265 of query aligns to 6:273/278 of 5uavA
2graA Crystal structure of human pyrroline-5-carboxylate reductase complexed with NADP (see paper)
29% identity, 98% coverage: 4:264/265 of query aligns to 4:271/277 of 2graA
2gr9A Crystal structure of p5cr complexed with nadh (see paper)
29% identity, 98% coverage: 4:264/265 of query aligns to 4:271/277 of 2gr9A
6xp1B Structure of human pycr1 complexed with l-thiazolidine-2-carboxylate (see paper)
29% identity, 98% coverage: 4:264/265 of query aligns to 8:275/281 of 6xp1B
P32322 Pyrroline-5-carboxylate reductase 1, mitochondrial; P5C reductase 1; P5CR 1; EC 1.5.1.2 from Homo sapiens (Human) (see 4 papers)
29% identity, 98% coverage: 4:264/265 of query aligns to 2:269/319 of P32322
Sites not aligning to the query:
>207819 MicrobesOnline__882:207819
MQTTLGCIGCGNMGSAILRGLSGREGLRLVGCDPTGAKLAALADAGVEGVADIAAAVRAS
DIVLVAVKPGQVGAVLGAAMPELDSGKVVVSIASGVSVGSLREMSGGRCPVVRVMPNTPA
MVGAGVFALCFEDATLDEVRRTLVKELFEALGRVLVLPEEKFNAFTAVVGCGPAYVFHFM
EAVVEAAVTLGFPRHEATDMVVDLFAGSVKLAATSGTHLSLLREAVCSPAGNTIAAMNQF
DRDAVRGRIIDAILAAYRRGQEMER
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory