SitesBLAST
Comparing 208172 MicrobesOnline__882:208172 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
Q9SS48 Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial; Protein SUGAR-DEPENDENT 6; EC 1.1.5.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 97% coverage: 4:381/389 of query aligns to 76:473/629 of Q9SS48
- S86 (≠ A14) mutation to F: In spd6-2; loss of 90% of activity.
Sites not aligning to the query:
- 546 E→G: In spd6-1; loss of 90% of activity.
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
28% identity, 57% coverage: 17:239/389 of query aligns to 20:243/374 of 1y56B
- active site: F44 (≠ G41), G47 (≠ H48), T48 (≠ S49), H224 (≠ G224), P239 (≠ E235)
- binding flavin-adenine dinucleotide: I33 (≠ F30), E34 (= E31), K35 (≠ R32), S42 (≠ A39), T43 (= T40), R45 (= R42), C46 (≠ L47), G47 (≠ H48), G49 (= G50), E170 (= E166), V171 (= V167), T200 (≠ A202), N201 (≠ G203), W203 (= W205)
- binding flavin mononucleotide: F44 (≠ G41), R45 (= R42)
Sites not aligning to the query:
- active site: 305, 338
- binding flavin-adenine dinucleotide: 11, 13, 14, 15, 305, 306, 307, 334, 335, 336, 337, 338
- binding flavin mononucleotide: 260, 301, 303
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
27% identity, 56% coverage: 4:221/389 of query aligns to 4:219/827 of 1pj7A
- binding flavin-adenine dinucleotide: G8 (= G8), G10 (= G10), I11 (≠ G11), V12 (≠ T12), D32 (≠ E31), Q33 (≠ R32), G41 (= G38), S42 (≠ A39), T43 (= T40), H45 (≠ R42), P47 (≠ H44), L49 (= L46), T170 (≠ E166), V171 (= V167), A200 (= A202), G201 (= G203), W203 (= W205)
Sites not aligning to the query:
- active site: 222, 256, 549
- binding flavin-adenine dinucleotide: 222, 256, 331, 357, 358, 359, 360
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: 505, 536, 549, 551, 563, 629, 648, 655, 696
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
27% identity, 56% coverage: 4:221/389 of query aligns to 4:219/827 of 3gsiA
- binding flavin-adenine dinucleotide: G10 (= G10), I11 (≠ G11), V12 (≠ T12), D32 (≠ E31), Q33 (≠ R32), G41 (= G38), S42 (≠ A39), T43 (= T40), H45 (≠ R42), P47 (≠ H44), L49 (= L46), T170 (≠ E166), V171 (= V167), A200 (= A202), G201 (= G203), W203 (= W205)
Sites not aligning to the query:
- active site: 222, 256, 549
- binding flavin-adenine dinucleotide: 222, 256, 330, 331, 332, 357, 358, 359, 360
- binding magnesium ion: 254, 409
- binding (6s)-5,6,7,8-tetrahydrofolate: 505, 536, 551, 563, 629, 648, 655, 696
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
27% identity, 56% coverage: 4:221/389 of query aligns to 5:220/828 of 1pj6A
- binding flavin-adenine dinucleotide: G9 (= G8), G11 (= G10), I12 (≠ G11), V13 (≠ T12), D33 (≠ E31), Q34 (≠ R32), G42 (= G38), S43 (≠ A39), T44 (= T40), H46 (≠ R42), P48 (≠ H44), L50 (= L46), V172 (= V167), A201 (= A202), G202 (= G203), W204 (= W205)
Sites not aligning to the query:
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
27% identity, 56% coverage: 4:221/389 of query aligns to 7:222/830 of Q9AGP8
Sites not aligning to the query:
- 225 Important for catalytic activity; H→Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- 259 Important for catalytic activity; binding ; Y→F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- 360:363 binding
- 539 binding
- 552 Important for catalytic activity; D→A: No effect on the activity.; D→N: Reduces activity 3-fold.
2rgoA Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
21% identity, 85% coverage: 24:354/389 of query aligns to 41:391/557 of 2rgoA
- binding flavin-adenine dinucleotide: E48 (= E31), M49 (≠ R32), Q50 (≠ G33), T56 (≠ A39), S57 (≠ T40), A197 (≠ V167), S232 (≠ A202), G233 (= G203), W235 (= W205), G257 (= G224), G344 (≠ A304), L345 (≠ A305), Y357 (vs. gap), K382 (= K345), I383 (≠ A346), T384 (≠ M347)
Sites not aligning to the query:
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
24% identity, 75% coverage: 19:311/389 of query aligns to 21:312/370 of 4yshA
- active site: A45 (≠ H43), M48 (≠ L46), L49 (= L47), Q52 (≠ G50), I262 (≠ G260), L283 (≠ M282), G305 (≠ A304)
- binding flavin-adenine dinucleotide: F32 (= F30), E33 (= E31), K34 (≠ R32), G40 (= G38), A41 (= A39), S42 (≠ T40), A45 (≠ H43), A46 (≠ H44), G47 (= G45), M48 (≠ L46), V178 (= V167), S206 (≠ A202), G207 (= G203), W209 (= W205), R307 (= R306)
Sites not aligning to the query:
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
24% identity, 75% coverage: 19:311/389 of query aligns to 21:312/368 of 4yshB
- active site: A45 (≠ H43), M48 (≠ L46), L49 (= L47), Q52 (≠ G50), I262 (≠ G260), L283 (≠ M282), G305 (≠ A304)
- binding flavin-adenine dinucleotide: F32 (= F30), E33 (= E31), K34 (≠ R32), G40 (= G38), A41 (= A39), S42 (≠ T40), A45 (≠ H43), A46 (≠ H44), M48 (≠ L46), V178 (= V167), S206 (≠ A202), W209 (= W205), R307 (= R306)
- binding glycine: G249 (= G247), Y251 (≠ I249), Y251 (≠ I249), A264 (≠ S262), R307 (= R306)
Sites not aligning to the query:
- active site: 335, 338
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 332, 334, 335, 336, 337, 338
- binding glycine: 334, 334
3dmeA Crystal structure of conserved exported protein from bordetella pertussis. Northeast structural genomics target ber141
29% identity, 53% coverage: 6:210/389 of query aligns to 7:211/366 of 3dmeA
- binding flavin-adenine dinucleotide: I8 (= I7), G9 (= G8), G11 (= G10), V12 (≠ G11), V13 (≠ T12), E32 (= E31), A33 (≠ R32), T41 (≠ A39), S42 (≠ T40), R44 (= R42), N45 (≠ H43), S46 (≠ H44), V48 (≠ L46), H50 (= H48), P170 (≠ E166), L171 (≠ V167), A203 (= A202)
Sites not aligning to the query:
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
24% identity, 75% coverage: 19:311/389 of query aligns to 22:314/377 of Q5L2C2
Sites not aligning to the query:
- 14:15 binding
- 334:340 binding
- 336 binding
Query Sequence
>208172 MicrobesOnline__882:208172
MEHIAIIGGGGTAAALAHDLVLRGFAVSLFERGEFFSGATGRHHGLLHSGGRYAVNDKEA
ARECIEENRLLRTLVPEAIEQNGGLFVAMDDEDMDYLPVFVESCAECGIPTRQMSGDAAR
ELEPALSASVRAAVQVPDATFDAWRLPLPFLATARANGAQTHHFTEVVGVHTRAGAVHGL
RVRDIRLGTERDVAADVVINAAGAWAGNIAALAGIEVPIQPGPGVLVAIEGRVTEMVINR
LRRPGEGDIIVPQRILSVLGTSLWLADAPDRLSIPEEHVQRMVDNCSHMVPACADRPRRS
AWSAARPLIRDPGASRLQDISRTFDCYDHGKRDGVRGFFSIIGGKAMTLRAMAEKTADVI
CASLGLDAGAHPCRTRTTPLLPYRAFYRS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory