SitesBLAST
Comparing 208241 MicrobesOnline__882:208241 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4r1mA Crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.48 a resolution
60% identity, 98% coverage: 8:430/432 of query aligns to 12:434/435 of 4r1mA
- binding adenosine monophosphate: A215 (= A210), E216 (= E211), P217 (= P212), N236 (= N231), S237 (= S232), F238 (≠ Y233), G239 (= G234), M240 (≠ L235), T241 (≠ S236), D305 (= D300), R329 (= R324), I335 (= I330), N340 (= N335)
- binding zinc ion: C252 (= C247), H259 (= H254), C314 (= C309), C316 (= C311)
4r1lA Crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.42 a resolution
59% identity, 98% coverage: 8:430/432 of query aligns to 12:432/433 of 4r1lA
- binding adenosine-5'-diphosphate: A215 (= A210), E216 (= E211), P217 (= P212), S237 (= S232), F238 (≠ Y233), G239 (= G234), M240 (≠ L235), T241 (≠ S236), D305 (= D300), R329 (= R324), N340 (= N335)
- binding adenosine monophosphate: A215 (= A210), E216 (= E211), P217 (= P212), S237 (= S232), F238 (≠ Y233), G239 (= G234), M240 (≠ L235), T241 (≠ S236), D305 (= D300), R329 (= R324), N340 (= N335)
- binding coenzyme a: S136 (≠ M131), A164 (≠ P159), G165 (= G160), N166 (= N161), S167 (≠ T162), I185 (= I180), Y188 (= Y183), K337 (= K332), T408 (= T404)
- binding zinc ion: C252 (= C247), H259 (= H254), C314 (= C309), C316 (= C311)
2y4oA Crystal structure of paak2 in complex with phenylacetyl adenylate (see paper)
47% identity, 98% coverage: 8:430/432 of query aligns to 10:433/433 of 2y4oA
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: F135 (≠ T132), F140 (= F137), A213 (= A210), E214 (= E211), P215 (= P212), I235 (≠ S232), G237 (= G234), L238 (= L235), S239 (= S236), P244 (= P241), D304 (= D300), R325 (= R324), I331 (= I330), N336 (= N335)
2y4oB Crystal structure of paak2 in complex with phenylacetyl adenylate (see paper)
47% identity, 98% coverage: 8:429/432 of query aligns to 10:432/432 of 2y4oB
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: F135 (≠ T132), F140 (= F137), G212 (= G209), A213 (= A210), E214 (= E211), P215 (= P212), I235 (≠ S232), G237 (= G234), L238 (= L235), S239 (= S236), P244 (= P241), D304 (= D300), R325 (= R324), I331 (= I330), N336 (= N335)
- binding magnesium ion: S204 (≠ L201), V228 (≠ L225)
2y27B Crystal structure of paak1 in complex with atp from burkholderia cenocepacia (see paper)
46% identity, 98% coverage: 8:429/432 of query aligns to 8:427/427 of 2y27B
- binding adenosine-5'-triphosphate: K65 (= K64), S90 (= S89), S91 (= S90), G92 (= G91), T93 (= T92), T94 (= T93), F138 (= F137), A211 (= A210), E212 (= E211), P213 (= P212), D232 (≠ N231), I233 (≠ S232), Y234 (= Y233), G235 (= G234), L236 (= L235), S237 (= S236), D302 (= D300), I320 (≠ M321), R323 (= R324), K419 (= K421)
- binding magnesium ion: V200 (≠ H199), S202 (≠ L201), L204 (≠ P203), M226 (≠ L225), G227 (= G226), Q347 (≠ F348), L350 (≠ V351)
2y4nA Paak1 in complex with phenylacetyl adenylate (see paper)
46% identity, 98% coverage: 8:430/432 of query aligns to 8:426/426 of 2y4nA
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: Y131 (≠ T132), F136 (= F137), G138 (= G139), G208 (= G209), A209 (= A210), E210 (= E211), P211 (= P212), I231 (≠ S232), Y232 (= Y233), G233 (= G234), L234 (= L235), S235 (= S236), P240 (= P241), D300 (= D300), R321 (= R324), K417 (= K421)
- binding magnesium ion: V198 (≠ H199), S200 (≠ L201), Q345 (≠ F348), L348 (≠ V351)
6he0A Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in complex with 2-hib-amp and coa in the thioesterfication state (see paper)
33% identity, 99% coverage: 3:430/432 of query aligns to 25:465/477 of 6he0A
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] 2-methyl-2-oxidanyl-propanoate: S241 (≠ G209), G242 (≠ A210), E243 (= E211), P244 (= P212), G267 (≠ Y233), S268 (≠ G234), M269 (≠ L235), A270 (≠ S236), D335 (= D300), I357 (≠ M321), N371 (= N335)
- binding adenosine monophosphate: G242 (≠ A210), E243 (= E211), P244 (= P212), C266 (≠ S232), G267 (≠ Y233), S268 (≠ G234), A270 (≠ S236), E271 (= E237), D335 (= D300), N371 (= N335)
- binding coenzyme a: Y166 (≠ F137), A188 (vs. gap), G189 (vs. gap), P191 (= P159), S194 (≠ T162), Y210 (≠ H178), G211 (≠ I179), T212 (≠ I180), Y215 (= Y183), H218 (≠ Y186), R368 (≠ K332), G369 (= G333), M401 (≠ I365), V439 (= V403), R440 (≠ T404)
6hdyA Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in the postadenylation state in complex with s3-hb-amp (see paper)
32% identity, 99% coverage: 3:430/432 of query aligns to 25:462/474 of 6hdyA
- binding (3s)-3-hydroxybutanoic acid: Y162 (≠ F137), S237 (≠ G209), G263 (≠ Y233), S264 (≠ G234), M265 (≠ L235), A266 (≠ S236), F271 (≠ G242)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] (3~{S})-3-oxidanylbutanoate: Y162 (≠ F137), G164 (= G139), S237 (≠ G209), G238 (≠ A210), E239 (= E211), P240 (= P212), C262 (≠ S232), G263 (≠ Y233), S264 (≠ G234), A266 (≠ S236), F271 (≠ G242), D331 (= D300), I353 (≠ M321), R356 (= R324), K453 (= K421)
6hdxA Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in the postadenylation state in complex with r3-hib-amp (see paper)
32% identity, 99% coverage: 3:430/432 of query aligns to 25:462/474 of 6hdxA
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] (2~{R})-2-methyl-3-oxidanyl-propanoate: Y162 (≠ F137), G164 (= G139), S237 (≠ G209), G238 (≠ A210), E239 (= E211), P240 (= P212), C262 (≠ S232), G263 (≠ Y233), S264 (≠ G234), A266 (≠ S236), F271 (≠ G242), D331 (= D300), I353 (≠ M321), R356 (= R324), K453 (= K421)
- binding (2r)-3-hydroxy-2-methylpropanoic acid: Y162 (≠ F137), G164 (= G139), S237 (≠ G209), G263 (≠ Y233), S264 (≠ G234), A266 (≠ S236), F271 (≠ G242)
6sixB Paak family amp-ligase with anp (see paper)
33% identity, 78% coverage: 14:349/432 of query aligns to 20:348/437 of 6sixB
- binding phosphoaminophosphonic acid-adenylate ester: S88 (= S89), S89 (= S90), A213 (= A210), E214 (= E211), P215 (= P212), E236 (≠ S232), Y237 (= Y233), G238 (= G234), S239 (≠ L235), T240 (≠ S236), E241 (= E237), D300 (= D300), V320 (≠ M321), R323 (= R324)
- binding magnesium ion: R79 (= R80), E80 (≠ T81), P121 (≠ R124), T150 (= T154)
- binding zinc ion: C249 (= C247), H255 (= H254), C309 (= C309), C311 (= C311)
6siyA Paak family amp-ligase with amp and substrate (see paper)
33% identity, 78% coverage: 14:349/432 of query aligns to 16:344/433 of 6siyA
- binding 3-hydroxyanthranilic acid: T125 (= T132), P126 (≠ G133), T132 (≠ G139), L135 (= L143), R153 (≠ N161), N177 (≠ I180), A209 (= A210), E232 (≠ S232), G234 (= G234), S235 (≠ L235)
- binding adenosine monophosphate: S85 (= S90), A209 (= A210), E210 (= E211), P211 (= P212), E232 (≠ S232), Y233 (= Y233), G234 (= G234), S235 (≠ L235), T236 (≠ S236), D296 (= D300), V316 (≠ M321)
- binding magnesium ion: R75 (= R80), E76 (≠ T81), L78 (≠ M83), P117 (≠ R124), G144 (≠ C152), A145 (≠ L153), T146 (= T154)
6siwA Paak family amp-ligase with amp (see paper)
33% identity, 78% coverage: 14:349/432 of query aligns to 15:343/432 of 6siwA
- binding adenosine monophosphate: S84 (= S90), A208 (= A210), E209 (= E211), P210 (= P212), E231 (≠ S232), Y232 (= Y233), G233 (= G234), S234 (≠ L235), T235 (≠ S236), D295 (= D300), V315 (≠ M321)
- binding magnesium ion: E75 (≠ T81), L77 (≠ M83), S83 (= S89), P116 (≠ R124), G143 (≠ C152), T145 (= T154), E236 (= E237)
- binding zinc ion: C244 (= C247), H250 (= H254), C304 (= C309), C306 (= C311)
P40806 Polyketide synthase PksJ; PKS from Bacillus subtilis (strain 168) (see paper)
27% identity, 78% coverage: 89:425/432 of query aligns to 195:552/5043 of P40806
Sites not aligning to the query:
- 1689 modified: O-(pantetheine 4'-phosphoryl)serine
6e8oA Crystal structure of aryl acid adenylating enzyme fscc from fuscachelin nrps in complex with amp
26% identity, 79% coverage: 37:377/432 of query aligns to 138:484/536 of 6e8oA
- active site: S190 (= S89), S210 (vs. gap), H234 (≠ Q129), A336 (≠ S236), E337 (= E237), N437 (≠ I330), K442 (≠ N335)
- binding adenosine monophosphate: H234 (≠ Q129), G310 (≠ A210), A311 (≠ E211), K312 (≠ P212), V332 (≠ S232), F333 (≠ Y233), G334 (= G234), M335 (≠ L235), A336 (≠ S236), D416 (≠ R313), V428 (≠ M321), K442 (≠ N335)
Sites not aligning to the query:
6e97B Crystal structure of the aryl acid adenylating enzyme fscc from fuscachelin nrps in complex with dhb-adenylate
26% identity, 79% coverage: 37:377/432 of query aligns to 138:484/537 of 6e97B
- active site: S190 (= S89), S210 (vs. gap), H234 (≠ Q129), A336 (≠ S236), E337 (= E237), N437 (≠ I330), K442 (≠ N335)
- binding 5'-O-[(S)-[(2,3-dihydroxybenzene-1-carbonyl)oxy](hydroxy)phosphoryl]adenosine: H234 (≠ Q129), N235 (= N130), F236 (vs. gap), S240 (≠ G133), G310 (≠ A210), A311 (≠ E211), K312 (≠ P212), V332 (≠ S232), F333 (≠ Y233), G334 (= G234), M335 (≠ L235), A336 (≠ S236), D416 (≠ R313), K433 (≠ D326), K442 (≠ N335)
Sites not aligning to the query:
6m2uA The crystal structure of benzoate coenzyme a ligase double mutant (h333a/i334a) in complex with 2-chloro-1,3-thiazole-5-carboxylate-amp (see paper)
28% identity, 79% coverage: 89:430/432 of query aligns to 176:515/518 of 6m2uA
- active site: S176 (= S89), T196 (≠ W109), T324 (≠ S236), E325 (= E237), K422 (≠ I330), Y427 (≠ N335), K507 (= K421)
- binding adenosine monophosphate: G298 (≠ A210), E299 (= E211), A300 (≠ P212), D319 (≠ N231), G320 (≠ S232), I321 (≠ Y233), G322 (= G234), T324 (≠ S236), D401 (≠ R313), R416 (= R324), K422 (≠ I330), Y427 (≠ N335)
- binding 2-chloranyl-1,3-thiazole-5-carboxylic acid: Y223 (≠ G139), A297 (≠ G209), G322 (= G234), S323 (≠ L235), A328 (≠ V243)
6m2tA The crystal structure of benzoate coenzyme a ligase double mutant (h333a/i334a) in complex with 2-methyl-thiazole-5 carboxylate-amp
28% identity, 79% coverage: 89:430/432 of query aligns to 176:515/518 of 6m2tA
- active site: S176 (= S89), T196 (≠ W109), T324 (≠ S236), E325 (= E237), K422 (≠ I330), Y427 (≠ N335), K507 (= K421)
- binding 2-methyl-1,3-thiazole-5-carboxylic acid: Y223 (≠ G139), G322 (= G234), S323 (≠ L235), A328 (≠ V243)
- binding adenosine monophosphate: G298 (≠ A210), E299 (= E211), A300 (≠ P212), G320 (≠ S232), I321 (≠ Y233), S323 (≠ L235), T324 (≠ S236), D401 (≠ R313), R416 (= R324), K422 (≠ I330), Y427 (≠ N335)
4rm2A Crystal structure of a benzoate coenzyme a ligase with 2-fluoro benzoic acid (see paper)
26% identity, 79% coverage: 89:430/432 of query aligns to 176:515/516 of 4rm2A
- active site: S176 (= S89), T196 (≠ W109), T324 (≠ S236), E325 (= E237), K422 (≠ I330), Y427 (≠ N335), K507 (= K421)
- binding 2-fluorobenzoic acid: A216 (≠ M131), A222 (≠ T138), Y223 (≠ G139), P246 (= P156), T247 (≠ A157), V251 (≠ N161), F267 (≠ V177), G269 (≠ I179), A270 (≠ I180), G273 (≠ Y183), M277 (≠ L187), A297 (≠ G209), G298 (≠ A210), I321 (≠ Y233), G322 (= G234), S323 (≠ L235), H328 (= H254), K422 (≠ I330)
4rlfB Crystal structure of a benzoate coenzyme a ligase with p-toluic acid and o-toluic acid (see paper)
26% identity, 79% coverage: 89:430/432 of query aligns to 176:515/519 of 4rlfB
- active site: S176 (= S89), T196 (≠ W109), T324 (≠ S236), E325 (= E237), K422 (≠ I330), Y427 (≠ N335), K507 (= K421)
- binding 2-methylbenzoic acid: A222 (≠ T138), Y223 (≠ G139), G298 (≠ A210), I321 (≠ Y233), G322 (= G234), S323 (≠ L235), H328 (= H254)
- binding 4-methylbenzoic acid: A216 (≠ M131), P246 (= P156), P248 (≠ G158), G269 (≠ I179), A270 (≠ I180), G273 (≠ Y183)
4zjzA Crystal structure of a benzoate coenzyme a ligase with benzoyl-amp (see paper)
26% identity, 79% coverage: 89:430/432 of query aligns to 176:515/517 of 4zjzA
- active site: S176 (= S89), T196 (≠ W109), T324 (≠ S236), E325 (= E237), K422 (≠ I330), Y427 (≠ N335), K507 (= K421)
- binding 5'-O-[(R)-(benzoyloxy)(hydroxy)phosphoryl]adenosine: A222 (≠ T138), Y223 (≠ G139), A297 (≠ G209), G298 (≠ A210), E299 (= E211), A300 (≠ P212), G320 (≠ S232), I321 (≠ Y233), G322 (= G234), S323 (≠ L235), T324 (≠ S236), H328 (= H254), I329 (≠ V255), D401 (≠ R313), R416 (= R324), K422 (≠ I330), Y427 (≠ N335)
Query Sequence
>208241 MicrobesOnline__882:208241
MEFFDIAETWNRDEIRQAQLVRLRNTVEQAMRSSFYGATLRKAGITPDSIRSLDDLRRIP
FTTKDDLRNQYPDGLNCVPRTEMVRMHASSGTTGSPTVVYHTQSDLNAWADLMARCLHMV
GVRRDDVFQNMTGYGLFTGGLGLHYGAERLGCLTIPAGPGNTKRQVKLMRDFRTSVVHII
PSYALYLAAAVEEGGEDPHALPPRIAVIGAEPHTEEARRRIEEMLGLKAFNSYGLSEMNG
PGVAFECTEQNGMHVWEDAYIAEIIDPATGEPVPDGEVGELVMTTLCRRGMPVLRYRTRD
LTRFLPGECPCGRVHRRLDRMVGRADDMLIIKGVNIYPMQIEQVLMAFPEVGQNYLIVLE
REEFIDQIKVKVELRDEAFVEDMRVLQGLQKAIARRLKDEILVTPRVELVQNNSLPKAEG
KAQRVLDLREKP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory