Comparing 208271 MicrobesOnline__882:208271 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ev5A Crystal structure of bleg-1 b3 metallo-beta-lactamase (see paper)
37% identity, 96% coverage: 4:203/208 of query aligns to 3:207/209 of 7ev5A
2zwrB Crystal structure of ttha1623 from thermus thermophilus hb8 (see paper)
37% identity, 97% coverage: 3:203/208 of query aligns to 1:200/207 of 2zwrB
2zziA Crystal structure of ttha1623 in a di-iron-bound form (see paper)
38% identity, 94% coverage: 8:203/208 of query aligns to 6:198/198 of 2zziA
7l0bA Crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme (see paper)
36% identity, 96% coverage: 1:199/208 of query aligns to 2:197/202 of 7l0bA
2xf4A Crystal structure of salmonella enterica serovar typhimurium ycbl (see paper)
31% identity, 99% coverage: 1:205/208 of query aligns to 1:210/210 of 2xf4A
4ysbA Crystal structure of ethe1 from myxococcus xanthus (see paper)
34% identity, 87% coverage: 22:201/208 of query aligns to 24:188/225 of 4ysbA
O95571 Persulfide dioxygenase ETHE1, mitochondrial; Ethylmalonic encephalopathy protein 1; Hepatoma subtracted clone one protein; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Homo sapiens (Human) (see 4 papers)
34% identity, 89% coverage: 19:203/208 of query aligns to 43:215/254 of O95571
Sites not aligning to the query:
4chlB Human ethylmalonic encephalopathy protein 1 (hethe1) (see paper)
35% identity, 88% coverage: 20:201/208 of query aligns to 28:197/237 of 4chlB
5ve5A Crystal structure of persulfide dioxygenase rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans in complex with glutathione (see paper)
33% identity, 88% coverage: 22:204/208 of query aligns to 27:197/350 of 5ve5A
Sites not aligning to the query:
2gcuA X-ray structure of gene product from arabidopsis thaliana at1g53580 (see paper)
31% identity, 88% coverage: 19:201/208 of query aligns to 25:201/244 of 2gcuA
Q9C8L4 Persulfide dioxygenase ETHE1 homolog, mitochondrial; Glyoxalase II; Glx II; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 88% coverage: 19:201/208 of query aligns to 74:250/294 of Q9C8L4
2q42A Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 (see paper)
34% identity, 90% coverage: 1:187/208 of query aligns to 1:169/254 of 2q42A
Q9SID3 Hydroxyacylglutathione hydrolase 2, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
35% identity, 79% coverage: 23:187/208 of query aligns to 94:239/324 of Q9SID3
4yslA Crystal structure of sdoa from pseudomonas putida in complex with glutathione (see paper)
32% identity, 81% coverage: 20:187/208 of query aligns to 45:212/294 of 4yslA
Sites not aligning to the query:
4yskA Crystal structure of apo-form sdoa from pseudomonas putida (see paper)
32% identity, 81% coverage: 20:187/208 of query aligns to 45:212/294 of 4yskA
3r2uB 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. Aureus col
27% identity, 93% coverage: 1:193/208 of query aligns to 5:195/336 of 3r2uB
Sites not aligning to the query:
6sg9FL uS3m (see paper)
38% identity, 37% coverage: 124:200/208 of query aligns to 219:294/320 of 6sg9FL
Sites not aligning to the query:
3r2uA 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. Aureus col
25% identity, 92% coverage: 1:191/208 of query aligns to 3:201/348 of 3r2uA
5aebB Crystal structure of the class b3 di-zinc metallo-beta-lactamase lra- 12 from an alaskan soil metagenome. (see paper)
29% identity, 65% coverage: 6:140/208 of query aligns to 27:170/266 of 5aebB
Sites not aligning to the query:
3tp9A Crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains
27% identity, 81% coverage: 24:192/208 of query aligns to 28:203/473 of 3tp9A
>208271 MicrobesOnline__882:208271
MPIKTFPLGPLETNCHLVHNGRTAVVVDPGGAPRPVLNYLEMQGLTLTHILNTHLHFDHI
YGNAALAAATGAPILASAGDAFLRQTELGKGGAFGFPAVDDFTSIDLEPGEHRFGDLACT
AFATPGHTPGSLSFYFPEEDTIIVGDLIFYRSIGRTDFPGGDLEKLRASVRDHIFTLPGK
TRILPGHGPATSVDDETRNNPYFGDFAV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory