SitesBLAST
Comparing 208464 MicrobesOnline__882:208464 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
34% identity, 70% coverage: 151:515/520 of query aligns to 35:403/404 of 3wx9A
- binding 4-(2-aminophenyl)-2,4-dioxobutanoic acid: G40 (= G156), L41 (≠ N157)
- binding 2-oxoglutaric acid: D213 (= D324), P214 (≠ Y325), Y215 (≠ V326), G216 (= G327), E217 (≠ D328), G241 (= G352), T242 (= T353), I246 (≠ M357)
- binding (2E)-pent-2-enedioic acid: G40 (= G156), Y130 (= Y246), N184 (= N295), R376 (= R488)
- binding glutamic acid: L131 (≠ A247), V360 (≠ T471), A364 (≠ P475), R369 (≠ G480)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G220), S105 (= S221), Q106 (= Q222), Y130 (= Y246), N184 (= N295), D212 (= D323), P214 (≠ Y325), Y215 (≠ V326), T242 (= T353), S244 (= S355), K245 (= K356), R252 (= R363)
Sites not aligning to the query:
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
34% identity, 70% coverage: 151:515/520 of query aligns to 35:403/404 of 3av7A
- binding 4-hydroxyquinoline-2-carboxylic acid: L131 (≠ A247), Q135 (≠ A251), A364 (≠ P475), R369 (≠ G480)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: G40 (= G156), Y130 (= Y246), L131 (≠ A247), A132 (≠ D248), N184 (= N295), R376 (= R488)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G220), S105 (= S221), Q106 (= Q222), Y130 (= Y246), V179 (≠ M290), N184 (= N295), D212 (= D323), P214 (≠ Y325), Y215 (≠ V326), T242 (= T353), S244 (= S355), K245 (= K356), R252 (= R363)
Sites not aligning to the query:
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
34% identity, 70% coverage: 151:515/520 of query aligns to 35:403/404 of 3aowC
- binding 2-oxoglutaric acid: Y70 (= Y186), Y130 (= Y246), L275 (= L386)
- binding pyridoxal-5'-phosphate: G104 (= G220), S105 (= S221), Q106 (= Q222), Y130 (= Y246), V179 (≠ M290), N184 (= N295), D212 (= D323), P214 (≠ Y325), Y215 (≠ V326), T242 (= T353), S244 (= S355), K245 (= K356), R252 (= R363)
Sites not aligning to the query:
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
34% identity, 70% coverage: 151:515/520 of query aligns to 35:403/404 of 3aovA
- binding pyridoxal-5'-phosphate: G104 (= G220), S105 (= S221), Q106 (= Q222), Y130 (= Y246), V179 (≠ M290), N184 (= N295), D212 (= D323), P214 (≠ Y325), Y215 (≠ V326), T242 (= T353), S244 (= S355), K245 (= K356), R252 (= R363)
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
33% identity, 70% coverage: 151:515/520 of query aligns to 32:401/403 of 1wstA
- binding pyridoxal-5'-phosphate: G102 (= G220), S103 (= S221), Q104 (= Q222), Y128 (= Y246), V177 (≠ M290), N182 (= N295), D210 (= D323), P212 (≠ Y325), Y213 (≠ V326), T240 (= T353), S242 (= S355), K243 (= K356), R250 (= R363)
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
35% identity, 70% coverage: 149:510/520 of query aligns to 33:390/397 of 2zyjA
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: G39 (≠ S155), G40 (= G156), G99 (= G220), S100 (= S221), Q101 (= Q222), Y125 (= Y246), N174 (= N295), D202 (= D323), Y205 (≠ V326), S235 (≠ T353), S237 (= S355), K238 (= K356), R245 (= R363), R368 (= R488)
Sites not aligning to the query:
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
35% identity, 70% coverage: 149:510/520 of query aligns to 33:390/397 of Q72LL6
- G40 (= G156) binding
- Y70 (= Y186) binding
- N174 (= N295) binding ; binding
- R245 (= R363) binding
- R368 (= R488) binding
Sites not aligning to the query:
- 20 S→E: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate. Increases the affinity for leucine and 2-oxoisocaproate.
- 23 R→A: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.; R→Q: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
35% identity, 70% coverage: 149:510/520 of query aligns to 29:386/392 of 3cbfA
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]hexanedioic acid: G35 (≠ S155), G36 (= G156), G95 (= G220), S96 (= S221), Q97 (= Q222), Y121 (= Y246), N170 (= N295), D198 (= D323), Y201 (≠ V326), S231 (≠ T353), S233 (= S355), K234 (= K356), R241 (= R363), R364 (= R488)
Sites not aligning to the query:
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
35% identity, 70% coverage: 149:510/520 of query aligns to 29:386/392 of 2egyA
- binding pyridoxal-5'-phosphate: G95 (= G220), S96 (= S221), Q97 (= Q222), Y121 (= Y246), N170 (= N295), D198 (= D323), A200 (≠ Y325), Y201 (≠ V326), S231 (≠ T353), S233 (= S355), K234 (= K356), R241 (= R363)
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
35% identity, 70% coverage: 148:510/520 of query aligns to 24:382/389 of 2z1yA
- binding leucine: G32 (= G156), Y117 (= Y246), R360 (= R488)
- binding pyridoxal-5'-phosphate: G91 (= G220), S92 (= S221), Q93 (= Q222), Y117 (= Y246), N166 (= N295), D194 (= D323), Y197 (≠ V326), S227 (≠ T353), S229 (= S355), K230 (= K356), R237 (= R363)
2zc0A Crystal structure of an archaeal alanine:glyoxylate aminotransferase (see paper)
33% identity, 69% coverage: 151:508/520 of query aligns to 37:399/405 of 2zc0A
- active site: Y132 (= Y246), D214 (= D323), A216 (≠ Y325), S246 (= S355)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G106 (= G220), G107 (≠ S221), T108 (≠ Q222), Y132 (= Y246), N186 (= N295), D214 (= D323), A216 (≠ Y325), Y217 (≠ V326), T244 (= T353), S246 (= S355), K247 (= K356), R254 (= R363)
7zlaB Cryo-em structure of holo-pdxr from bacillus clausii bound to its target DNA in the half-closed conformation (see paper)
27% identity, 91% coverage: 5:479/520 of query aligns to 2:425/458 of 7zlaB
- binding : R4 (= R7), P9 (= P12), L10 (= L13), Y11 (= Y14), S35 (= S38), K36 (≠ I39), R37 (= R40), K38 (≠ R41), Q47 (≠ R50), Q47 (≠ R50), N48 (≠ V51), T49 (= T52), R68 (≠ G71)
1vp4A Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution
26% identity, 72% coverage: 147:518/520 of query aligns to 37:418/420 of 1vp4A
- binding pyridoxal-5'-phosphate: G112 (= G220), S113 (= S221), Q114 (= Q222), Y138 (= Y246), N194 (= N295), D222 (= D323), P224 (≠ Y325), Y225 (≠ V326), T252 (= T353), S254 (= S355), K255 (= K356), R262 (= R363)
6uxzB (S)-4-amino-5-phenoxypentanoate as a selective agonist of the transcription factor gabr (see paper)
30% identity, 69% coverage: 151:510/520 of query aligns to 3:356/358 of 6uxzB
- binding (4S)-4-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-5-phenoxypentanoic acid: H7 (≠ S155), M8 (≠ G156), G73 (= G220), T74 (≠ S221), Y98 (= Y246), R100 (≠ D248), F143 (≠ N295), D172 (= D323), Y174 (= Y325), T202 (= T353), S204 (= S355), K205 (= K356), P209 (= P360), R212 (= R363), R323 (≠ P475)
5t4kA Plp and gaba trigger gabr-mediated transcription regulation in bacillus subsidies via external aldimine formation (see paper)
30% identity, 69% coverage: 151:510/520 of query aligns to 4:357/360 of 5t4kA
- binding (4S)-5-fluoro-4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]pentanoic acid: H8 (≠ S155), M9 (≠ G156), T75 (≠ S221), Y99 (= Y246), F144 (≠ N295), D173 (= D323), Y175 (= Y325), T203 (= T353), S205 (= S355), R213 (= R363), R324 (≠ P475)
5t4jB Plp and gaba trigger gabr-mediated transcription regulation in bacillus subsidies via external aldimine formation (see paper)
30% identity, 69% coverage: 151:510/520 of query aligns to 4:357/360 of 5t4jB
- binding gamma-amino-butanoic acid: H8 (≠ S155), M9 (≠ G156), Y99 (= Y246), Y175 (= Y325), R324 (≠ P475)
- binding pyridoxal-5'-phosphate: T75 (≠ S221), Y99 (= Y246), F144 (≠ N295), D173 (= D323), Y175 (= Y325), T203 (= T353), S205 (= S355), R213 (= R363), S215 (≠ G365)
8tn3A Structure of s. Hygroscopicus aminotransferase mppq complexed with pyridoxamine 5'-phosphate (pmp) (see paper)
33% identity, 70% coverage: 149:511/520 of query aligns to 20:388/388 of 8tn3A
3ue8A Kynurenine aminotransferase ii inhibitors (see paper)
25% identity, 70% coverage: 149:513/520 of query aligns to 15:407/410 of 3ue8A
- binding (5-hydroxy-4-{[(1-hydroxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: G22 (= G156), Y57 (= Y186), S100 (= S221), Q101 (= Q222), Y125 (= Y246), N185 (= N295), D213 (= D323), P215 (≠ Y325), Y216 (≠ V326), S243 (≠ T353), S245 (= S355), K246 (= K356), R253 (= R363), R382 (= R488)
2vgzA Crystal structure of human kynurenine aminotransferase ii (see paper)
25% identity, 71% coverage: 145:513/520 of query aligns to 17:413/414 of 2vgzA
5x03B Crystal structure of thE C-terminal domain of bacillus subtilis gabr reveals a closed conformation by the binding of gamma-aminobutyric acid, inducing the transcriptional activation (see paper)
30% identity, 69% coverage: 151:510/520 of query aligns to 3:361/365 of 5x03B
Query Sequence
>208464 MicrobesOnline__882:208464
MNIPLDRSLSLPLYAQVAAFIRAQIERGALEPGMRLPSIRRLSQDLGVNRVTIETAYGEL
EADGLVTARGGSGTFVLPPFPACALPSLDGRAVPAAPPAATGRKRGTASSASDAATVELP
RWQQALCDRRPDLSCDLMIPLQVPGPDEGPIALASGNSDARLFPLASFRRTLRTVLARDG
IKALEYEDPAGYAPLRRTIARILADQGVPATPDTVLVTAGSQQALHLVAQVVLKPGDPVY
VETPSYADGMALFRTLGLRIVPVFTDSEGMSAEGLREAIARHGHGLVFTMPNFQNPTGIC
MSGQRRRRIAAIAVAHGVPILEDDYVGDIRYEGYSQPSLHSLTPPGHTFYAGTFSKMLVP
GLRMGYLVAEGPVLRMLARVKRMYDLSTSSVVQRTLERFVDLGSYRAHLTRACRIYKVRR
DALLDSAVRHLPDDVTIAPVRGGLFAWMTLPEGVGATVLAHEAARHGVTVTPGTPFFAEG
LEGERHLRINFTQHDPEILEEGMRRLARAIARCRKGKHCA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory