SitesBLAST
Comparing 209274 MicrobesOnline__882:209274 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
41% identity, 48% coverage: 99:193/197 of query aligns to 57:166/203 of 6x3cE
- binding magnesium ion: N158 (≠ V185), P159 (= P186)
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: G78 (≠ A118), N80 (= N120), H81 (= H121), H91 (≠ M131), L92 (≠ F132), M101 (vs. gap), P102 (vs. gap)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: G69 (= G111), H81 (= H121), M83 (≠ F123), W120 (= W147), G122 (≠ A149), A140 (≠ G167), A141 (= A168)
Sites not aligning to the query:
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: 53
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: 51
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
42% identity, 48% coverage: 99:193/197 of query aligns to 57:166/212 of 4husA
Sites not aligning to the query:
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
42% identity, 48% coverage: 99:193/197 of query aligns to 57:166/211 of 4hurA
- binding acetyl coenzyme *a: S67 (≠ T109), I68 (≠ V110), G69 (= G111), A79 (= A119), N80 (= N120), K110 (vs. gap), W120 (= W147), I121 (= I148), G122 (≠ A149), R123 (≠ A150), M128 (≠ V155), A140 (≠ G167), A141 (= A168), T146 (= T173), G156 (≠ A183), P159 (= P186), I163 (= I190), R164 (= R191)
Sites not aligning to the query:
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
41% identity, 48% coverage: 99:193/197 of query aligns to 57:166/206 of 6x3jA
- binding (2R)-2-[(3S,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-4,12-dimethyl-1,7,22-trioxo-4,7,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,3H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosin-3-yl]propyl isoquinolin-3-ylcarbamate: H91 (≠ M131), L92 (≠ F132), M101 (vs. gap), P102 (vs. gap), L107 (vs. gap)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: G69 (= G111), A79 (= A119), H81 (= H121), W120 (= W147), G122 (≠ A149)
Sites not aligning to the query:
- binding (2R)-2-[(3S,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-4,12-dimethyl-1,7,22-trioxo-4,7,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,3H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosin-3-yl]propyl isoquinolin-3-ylcarbamate: 51, 53, 55
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
41% identity, 48% coverage: 99:193/197 of query aligns to 57:166/207 of 6x3cA
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: G78 (≠ A118), N80 (= N120), H81 (= H121), H91 (≠ M131), L92 (≠ F132), M101 (vs. gap), P102 (vs. gap), L104 (vs. gap)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: G69 (= G111), N80 (= N120), H81 (= H121), W120 (= W147), G122 (≠ A149), R123 (≠ A150), M128 (≠ V155), A140 (≠ G167), A141 (= A168)
Sites not aligning to the query:
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: 17, 36, 53
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: 51
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
39% identity, 55% coverage: 83:191/197 of query aligns to 77:182/185 of 3nz2J
- binding acetyl coenzyme *a: G104 (= G111), Y110 (≠ R117), H114 (= H121), W138 (= W147), G140 (≠ A149), A158 (≠ G167), A159 (= A168), N164 (≠ T173), G174 (≠ A183), T176 (≠ V185), P177 (= P186), R182 (= R191)
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
39% identity, 55% coverage: 83:191/197 of query aligns to 74:179/183 of 3nz2C
- binding acetyl coenzyme *a: Y107 (≠ R117), H111 (= H121), G137 (≠ A149), A155 (≠ G167), A156 (= A168), N161 (≠ T173), G171 (≠ A183), T173 (≠ V185), P174 (= P186), L178 (≠ I190), R179 (= R191)
- binding magnesium ion: N157 (≠ G169), T173 (≠ V185)
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
39% identity, 55% coverage: 83:191/197 of query aligns to 67:172/176 of 3ectA
P50870 Streptogramin A acetyltransferase; Virginiamycin acetyltransferase D; Vat(D); EC 2.3.1.- from Enterococcus faecium (Streptococcus faecium) (see paper)
30% identity, 66% coverage: 64:193/197 of query aligns to 28:167/209 of P50870
- H82 (= H121) mutation to A: 105-fold decrease in activity.
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
36% identity, 47% coverage: 101:193/197 of query aligns to 60:167/203 of 3dhoA
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
36% identity, 47% coverage: 101:193/197 of query aligns to 60:167/205 of 1kk4A
- binding acetyl coenzyme *a: I69 (≠ V110), G70 (= G111), K111 (vs. gap), W121 (= W147), G123 (≠ A149), K124 (≠ A150), A141 (≠ G167), A142 (= A168), V147 (≠ T173), K148 (= K174), L155 (≠ V181), G157 (≠ A183), G158 (= G184), P160 (= P186), I164 (= I190)
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
36% identity, 47% coverage: 101:193/197 of query aligns to 60:167/204 of 1mrlA
- binding 5-(2-diethylamino-ethanesulfonyl)-21-hydroxy-10-isopropyl-11,19-dimethyl-9,26-dioxa-3,15,28-triaza-tricyclo[23.2.1.00,255]octacosa-1(27),12,17,19,25(28)-pentaene-2,8,14,23-tetraone: N81 (= N120), H82 (= H121), L93 (≠ F132), M102 (vs. gap), L108 (vs. gap)
Sites not aligning to the query:
- binding 5-(2-diethylamino-ethanesulfonyl)-21-hydroxy-10-isopropyl-11,19-dimethyl-9,26-dioxa-3,15,28-triaza-tricyclo[23.2.1.00,255]octacosa-1(27),12,17,19,25(28)-pentaene-2,8,14,23-tetraone: 37, 39, 54, 56
1khrA Crystal structure of vat(d) in complex with virginiamycin and coenzyme a (see paper)
36% identity, 47% coverage: 101:193/197 of query aligns to 60:167/206 of 1khrA
- binding coenzyme a: H82 (= H121), M84 (≠ F123), W121 (= W147), A141 (≠ G167), A142 (= A168), V147 (≠ T173), L155 (≠ V181), G157 (≠ A183), P160 (= P186), I164 (= I190)
- binding virginiamycin m1: A80 (= A119), N81 (= N120), H82 (= H121), L93 (≠ F132)
Sites not aligning to the query:
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
35% identity, 56% coverage: 83:192/197 of query aligns to 77:183/190 of 5u2kA
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
38% identity, 56% coverage: 83:192/197 of query aligns to 77:183/186 of 4isxA
6u9cA The 2.2 a crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with acetyl coa
37% identity, 46% coverage: 104:193/197 of query aligns to 58:162/206 of 6u9cA
6pubA Crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with crystal violet
37% identity, 46% coverage: 104:193/197 of query aligns to 61:165/210 of 6pubA
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
33% identity, 60% coverage: 75:192/197 of query aligns to 69:183/200 of 1krrA
- binding acetyl coenzyme *a: N84 (= N90), I103 (≠ V110), A104 (≠ G111), P105 (= P112), T112 (≠ A119), H114 (= H121), G140 (≠ A149), S141 (≠ A150), N146 (≠ V155), G158 (= G167), A159 (= A168), A174 (= A183), P177 (= P186), R182 (= R191)
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 60% coverage: 75:192/197 of query aligns to 70:184/203 of P07464
- S71 (≠ A76) binding
- N85 (= N90) binding in other chain; binding in other chain
- D93 (≠ G99) binding
- H115 (= H121) mutation to A: Results in an 1800-fold decrease in catalytic activity.
- S142 (≠ A150) binding in other chain
- A160 (= A168) binding in other chain
- TK 165:166 (= TK 173:174) binding
- R180 (= R188) binding
- R183 (= R191) binding in other chain
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed; Partial
- 17 binding
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
33% identity, 60% coverage: 75:192/197 of query aligns to 69:183/201 of 1krvA
- binding 4-nitrophenyl beta-D-galactopyranoside: S70 (≠ A76), Y82 (≠ A88), N84 (= N90), V90 (≠ A97), D92 (≠ G99), M126 (vs. gap)
- binding coenzyme a: A104 (≠ G111), S110 (≠ R117), T112 (≠ A119), W138 (= W147), G140 (≠ A149), S141 (≠ A150), N146 (≠ V155), A159 (= A168), P177 (= P186), R179 (= R188), R182 (= R191)
Sites not aligning to the query:
Query Sequence
>209274 MicrobesOnline__882:209274
MARCAVFLEELWFALFAWVPTVLGTAVRLVAWRPLFRLLGGVCGKVRFGQSLTLQGAGHM
RLADGVRLGKGCHLYARTGELVMGENAALNINVVVDADGGTVRIGAHATVGPGTVIRAAN
HRFDRLDTPIMFQGHEYGEVVIDDDVWIAANCTVVPGVHIGRGAVVGAGAVVTKDVEPYT
VVAGVPARFIRRRGPAE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory