Comparing 209357 MicrobesOnline__882:209357 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pzlB The crystal structure of agmatine ureohydrolase of thermoplasma volcanium
34% identity, 89% coverage: 20:278/290 of query aligns to 21:278/293 of 3pzlB
Q57757 Agmatinase; EC 3.5.3.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
32% identity, 92% coverage: 20:285/290 of query aligns to 19:283/284 of Q57757
3lhlA Crystal structure of a putative agmatinase from clostridium difficile
33% identity, 64% coverage: 79:263/290 of query aligns to 65:248/276 of 3lhlA
3nioA Crystal structure of pseudomonas aeruginosa guanidinobutyrase (see paper)
32% identity, 70% coverage: 88:290/290 of query aligns to 105:315/316 of 3nioA
Q9I3S3 Guanidinobutyrase; EC 3.5.3.7 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
32% identity, 70% coverage: 88:290/290 of query aligns to 108:318/319 of Q9I3S3
7lbaB E. Coli agmatinase (see paper)
33% identity, 82% coverage: 26:263/290 of query aligns to 44:284/310 of 7lbaB
P60651 Agmatinase; Agmatine ureohydrolase; AUH; EC 3.5.3.11 from Escherichia coli (strain K12) (see paper)
33% identity, 84% coverage: 21:263/290 of query aligns to 32:277/306 of P60651
7lolA The structure of agmatinase from e. Coli at 1.8 a displaying urea and agmatine (see paper)
33% identity, 81% coverage: 30:263/290 of query aligns to 31:267/294 of 7lolA
P0DJQ3 Proclavaminate amidinohydrolase; Proclavaminic acid amidino hydrolase; EC 3.5.3.22 from Streptomyces clavuligerus (see paper)
31% identity, 82% coverage: 26:264/290 of query aligns to 34:283/313 of P0DJQ3
1gq6B Proclavaminate amidino hydrolase from streptomyces clavuligerus (see paper)
31% identity, 82% coverage: 26:264/290 of query aligns to 26:275/301 of 1gq6B
1wogA Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily (see paper)
35% identity, 68% coverage: 86:282/290 of query aligns to 96:295/303 of 1wogA
6vsuE Arginase from arabidopsis thaliana in complex with ornithine (see paper)
29% identity, 73% coverage: 76:287/290 of query aligns to 103:318/318 of 6vsuE
P46637 Arginase 1, mitochondrial; Agmatinase ARGAH1; Arginine amidohydrolase 1; AtARGAH1; EC 3.5.3.1; EC 3.5.3.11 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
29% identity, 73% coverage: 76:287/290 of query aligns to 127:342/342 of P46637
Sites not aligning to the query:
7loxA The structure of agmatinase from e. Coli at 3.2 a displaying guanidine in the active site (see paper)
33% identity, 79% coverage: 35:263/290 of query aligns to 26:257/284 of 7loxA
6vstA Arginase from medicago truncatula in complex with ornithine (see paper)
33% identity, 65% coverage: 76:263/290 of query aligns to 102:291/317 of 6vstA
6vstD Arginase from medicago truncatula in complex with ornithine (see paper)
33% identity, 65% coverage: 76:263/290 of query aligns to 105:294/320 of 6vstD
G7JFU5 Arginase, mitochondrial; Agmatinase ARGAH; Arginine amidohydrolase; MtARGAH; EC 3.5.3.1; EC 3.5.3.11 from Medicago truncatula (Barrel medic) (Medicago tribuloides) (see paper)
33% identity, 65% coverage: 76:263/290 of query aligns to 123:312/338 of G7JFU5
Sites not aligning to the query:
3nipB Crystal structure of pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane (see paper)
36% identity, 71% coverage: 85:289/290 of query aligns to 100:312/316 of 3nipB
Sites not aligning to the query:
3niqA Crystal structure of pseudomonas aeruginosa guanidinopropionase (see paper)
36% identity, 71% coverage: 85:289/290 of query aligns to 99:311/315 of 3niqA
Q9I6K2 Guanidinopropionase; EC 3.5.3.17 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
36% identity, 71% coverage: 85:289/290 of query aligns to 102:314/318 of Q9I6K2
>209357 MicrobesOnline__882:209357
MTDSPHKRFLASELDDIAPEEARFHVIPAPFEASVSYGGGTGAGPDAILDASDQLELWDG
LSIPAAQGIHTHPPVDCTGDAEAVLDRISRATRSVLDAGGTPVLLGGEHTVTYGALAALR
ERFGRFGVVQFDAHADLRDSYEGSRWSHASVMRRAVSDLGLPLVQYGVRALCTEEVAFRR
EAGVTHWDAAQLARSGVPARPLPDDFPESVYVTFDVDGLDPSIMPATGTPVPGGLGWYDA
LRLVERSVSGRRVLGFDVVELAPIAGWHAADFAAARLVYDIMGIIQRMAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory