Comparing 349777 FitnessBrowser__Btheta:349777 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
3ivaA Structure of the b12-dependent methionine synthase (meth) c-teminal half with adohcy bound (see paper)
41% identity, 98% coverage: 7:299/300 of query aligns to 288:572/576 of 3ivaA
Sites not aligning to the query:
3bulA E. Coli i690c/g743c meth c-terminal fragment (649-1227) (see paper)
41% identity, 98% coverage: 7:299/300 of query aligns to 288:572/577 of 3bulA
Sites not aligning to the query:
1mskA Methionine synthase (activation domain) (see paper)
41% identity, 98% coverage: 7:299/300 of query aligns to 38:322/327 of 1mskA
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
41% identity, 98% coverage: 7:299/300 of query aligns to 938:1222/1227 of P13009
Sites not aligning to the query:
6bdyA Crystal structure of the meth reactivation domain bound to sinefungin (see paper)
41% identity, 98% coverage: 7:299/300 of query aligns to 38:322/326 of 6bdyA
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
37% identity, 97% coverage: 5:296/300 of query aligns to 964:1257/1265 of Q99707
Sites not aligning to the query:
8sseA Methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8
24% identity, 88% coverage: 7:269/300 of query aligns to 244:506/507 of 8sseA
Sites not aligning to the query:
>349777 FitnessBrowser__Btheta:349777
MILSYKIHNVAPYINWIYFFHAWGFQPRFAAIANIHGCDVCRASWLTTFPEEDRNKASEA
MQLFKEANRMLDLLDKDYEVRTIFKLCKANSDGDNLVIEKETDQFLVFPLLRQQTPKRDG
SPFFCLSDFIRPLSSGIPDTIGAFASCIDADMEGLYEQDPYKHLLVQTLSDRLAEAATEK
MHEYVRKEAWGYAKDEILSMPDLLVEKYQGIRPAVGYPSLPDQSINFLLDELLDMKQIGI
TLTENGAMYPHASVCGLMFAHPAAEYFSVGKIGEDQLEDYARRRGKSTEEMRKFLAANLQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory