SitesBLAST
Comparing 349909 FitnessBrowser__Btheta:349909 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3w1vA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with inihibitor (see paper)
61% identity, 97% coverage: 4:342/349 of query aligns to 11:344/347 of 3w1vA
- binding [(2R,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,4-bis(oxidanyl)oxan-2-yl]methylimino-azanylidene-azanium: K93 (= K92), Q94 (= Q93), N175 (= N172), S179 (= S176), R180 (= R177), S182 (= S179), V183 (= V180), L186 (= L183), T198 (= T195), I199 (≠ L196), T200 (= T197), M204 (= M201), R206 (= R203), V240 (≠ I237), R263 (= R261), E266 (= E264)
4g5hA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with by-product (see paper)
61% identity, 97% coverage: 4:342/349 of query aligns to 11:344/346 of 4g5hA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G13), T22 (= T15), G23 (= G16), S24 (= S17), F25 (= F18), S45 (= S38), R46 (= R39), D47 (= D40), K50 (= K43), D69 (= D68), V70 (= V69), A89 (= A88), A90 (= A89), A91 (= A90), K93 (= K92), L131 (= L130), T133 (= T132), K147 (= K146), Y173 (= Y170)
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: Q94 (= Q93), V95 (= V94), K135 (= K134), N175 (= N172), S182 (= S179), V183 (= V180), L186 (= L183), T198 (= T195), T200 (= T197), M204 (= M201), V240 (≠ I237), R263 (= R261), E266 (= E264), Y278 (≠ C276), S313 (≠ L311), Y314 (≠ T312), E315 (= E313), Y316 (≠ F314), N320 (= N318)
3vvcA Crystal structure of capsular polysaccharide synthesizing enzyme cape , k126e, in apo form (see paper)
60% identity, 97% coverage: 4:342/349 of query aligns to 3:316/318 of 3vvcA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), T14 (= T15), G15 (= G16), F17 (= F18), S37 (= S38), R38 (= R39), D39 (= D40), K42 (= K43), D61 (= D68), V62 (= V69), R63 (= R70), A81 (= A88), A82 (= A89), A83 (= A90), K85 (= K92), S124 (= S131), T125 (= T132), K139 (= K146), Y165 (= Y170), G166 (= G171)
4j2oC Crystal structure of NADP-bound wbjb from a. Baumannii community strain d1279779 (see paper)
60% identity, 96% coverage: 3:338/349 of query aligns to 1:312/316 of 4j2oC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G13), T13 (= T15), G14 (= G16), S15 (= S17), F16 (= F18), S36 (= S38), R37 (= R39), D38 (= D40), K41 (= K43), D60 (= D68), V61 (= V69), A80 (= A88), A81 (= A89), A82 (= A90), K84 (= K92), T99 (= T107), L122 (= L130), K138 (= K146), Y164 (= Y170)
3vvbA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in apo form (see paper)
53% identity, 97% coverage: 4:341/349 of query aligns to 1:270/270 of 3vvbA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G13), T12 (= T15), G13 (= G16), S14 (= S17), F15 (= F18), S35 (= S38), R36 (= R39), D37 (= D40), K40 (= K43), D59 (= D68), V60 (= V69), A80 (= A89), A81 (= A90), K83 (= K92), L121 (= L130), T123 (= T132), K137 (= K146), Y163 (= Y170), G164 (= G171)
6bwcC X-ray structure of pen from bacillus thuringiensis (see paper)
37% identity, 82% coverage: 4:290/349 of query aligns to 3:291/327 of 6bwcC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), T14 (= T15), G15 (= G16), T16 (≠ S17), I17 (≠ F18), S37 (= S38), R38 (= R39), S39 (≠ D40), D63 (= D68), I64 (≠ V69), V83 (≠ A88), A84 (= A89), K87 (= K92), T125 (≠ L130), S127 (≠ T132), Y137 (≠ M142), K141 (= K146), F167 (≠ Y170), V170 (= V173), S173 (= S176), R174 (= R177)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K92), H88 (≠ Q93), S127 (≠ T132), N128 (≠ D133), Y137 (≠ M142), N169 (= N172), S176 (= S179), V177 (= V180), L180 (= L183), T192 (= T195), T194 (= T197), M198 (= M201), R200 (= R203), L234 (≠ I237), E265 (= E264)
O25511 UDP-N-acetylglucosamine 4,6-dehydratase (inverting); Pseudaminic acid biosynthesis protein B; UDP-GlcNAc-inverting 4,6-dehydratase; EC 4.2.1.115 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
38% identity, 82% coverage: 2:286/349 of query aligns to 6:283/333 of O25511
2gnaA Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-gal (see paper)
38% identity, 82% coverage: 2:286/349 of query aligns to 2:279/329 of 2gnaA
- binding galactose-uridine-5'-diphosphate: K87 (= K92), S176 (= S179), V177 (= V180), T195 (= T197), M199 (= M201), R201 (= R203), M235 (≠ I237), R254 (= R261), E257 (= E264)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), T15 (= T15), G16 (= G16), S17 (= S17), F18 (= F18), S39 (= S38), R40 (= R39), D41 (= D40), K44 (= K43), D63 (= D68), V64 (= V69), A83 (= A88), A84 (= A89), A85 (= A90), K87 (= K92), L125 (= L130), S126 (= S131), Y137 (≠ M142), K141 (= K146), Y167 (= Y170), G168 (= G171), V170 (= V173)
2gn9A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glc (see paper)
38% identity, 82% coverage: 2:286/349 of query aligns to 2:279/329 of 2gn9A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), T15 (= T15), G16 (= G16), S17 (= S17), F18 (= F18), R40 (= R39), D41 (= D40), K44 (= K43), D63 (= D68), V64 (= V69), A83 (= A88), A84 (= A89), A85 (= A90), K87 (= K92), L125 (= L130), S126 (= S131), K141 (= K146), Y167 (= Y170), G168 (= G171), V170 (= V173), R174 (= R177)
- binding uridine-5'-diphosphate-glucose: K87 (= K92), T127 (= T132), K129 (= K134), Y137 (≠ M142), N169 (= N172), S176 (= S179), V177 (= V180), P193 (≠ T195), T195 (= T197), M199 (= M201), R201 (= R203), M235 (≠ I237), R254 (= R261), E257 (= E264)
2gn6A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glcnac (see paper)
38% identity, 82% coverage: 2:286/349 of query aligns to 2:279/329 of 2gn6A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), T15 (= T15), G16 (= G16), S17 (= S17), F18 (= F18), R40 (= R39), D41 (= D40), K44 (= K43), D63 (= D68), V64 (= V69), A84 (= A89), A85 (= A90), K87 (= K92), S126 (= S131), Y137 (≠ M142), K141 (= K146), Y167 (= Y170), G168 (= G171), V170 (= V173), S173 (= S176), R174 (= R177)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K92), D128 (= D133), K129 (= K134), N169 (= N172), G175 (= G178), S176 (= S179), V177 (= V180), P193 (≠ T195), I194 (≠ L196), M199 (= M201), R201 (= R203), M235 (≠ I237), R254 (= R261), E257 (= E264)
2gn4A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADPH and udp-glcnac (see paper)
38% identity, 82% coverage: 2:286/349 of query aligns to 2:279/329 of 2gn4A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), T15 (= T15), G16 (= G16), S17 (= S17), F18 (= F18), S39 (= S38), R40 (= R39), D41 (= D40), K44 (= K43), D63 (= D68), V64 (= V69), A83 (= A88), A84 (= A89), A85 (= A90), K87 (= K92), T102 (= T107), L125 (= L130), S126 (= S131), T127 (= T132), Y137 (≠ M142), K141 (= K146), Y167 (= Y170), G168 (= G171), V170 (= V173), S173 (= S176), R174 (= R177)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K92), T127 (= T132), D128 (= D133), K129 (= K134), Y137 (≠ M142), N169 (= N172), S176 (= S179), V177 (= V180), P193 (≠ T195), T195 (= T197), M199 (= M201), R201 (= R203), M235 (≠ I237), R254 (= R261), E257 (= E264)
2gn8A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp (see paper)
39% identity, 80% coverage: 7:286/349 of query aligns to 5:277/327 of 2gn8A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G13), T13 (= T15), G14 (= G16), S15 (= S17), F16 (= F18), S37 (= S38), R38 (= R39), D39 (= D40), K42 (= K43), D61 (= D68), V62 (= V69), A81 (= A88), A82 (= A89), A83 (= A90), K85 (= K92), T100 (= T107), L123 (= L130), S124 (= S131), K139 (= K146), Y165 (= Y170), G166 (= G171), V168 (= V173), S171 (= S176), R172 (= R177)
- binding uridine-5'-diphosphate: K127 (= K134), N167 (= N172), V175 (= V180), P191 (≠ T195), I192 (≠ L196), T193 (= T197), M197 (= M201), R199 (= R203), M233 (≠ I237), R252 (= R261)
4tqgA Crystal structure of megavirus udp-glcnac 4,6-dehydratase, 5-epimerase mg534 (see paper)
33% identity, 88% coverage: 7:313/349 of query aligns to 6:288/297 of 4tqgA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ T15), G15 (= G16), S16 (= S17), L17 (≠ F18), R36 (= R39), D37 (= D40), D59 (= D68), I60 (≠ V69), A81 (= A88), A82 (= A89), A83 (= A90), K85 (= K92), V128 (≠ L130), Y140 (≠ M142), K144 (= K146), Y168 (= Y170), G169 (= G171), V171 (= V173)
5bjuA X-ray structure of the pglf dehydratase from campylobacter jejuni in complex with udp and NAD(h) (see paper)
33% identity, 87% coverage: 2:305/349 of query aligns to 20:317/340 of 5bjuA
- binding nicotinamide-adenine-dinucleotide: G31 (= G13), G34 (= G16), T35 (≠ S17), I36 (≠ F18), D56 (≠ S38), H57 (≠ R39), S82 (≠ F65), I83 (= I66), A104 (= A88), A105 (= A89), A106 (= A90), K108 (= K92), N123 (≠ T107), I146 (≠ L130), K162 (= K146), F184 (≠ Y170), G185 (= G171), N186 (= N172), V187 (= V173), S190 (= S176), S191 (≠ R177)
- binding uridine-5'-diphosphate: K150 (= K134), N186 (= N172), S193 (= S179), V194 (= V180), T209 (= T195), L210 (= L196), T211 (= T197), I215 (≠ M201), R217 (= R203), E279 (= E264)
5bjvA X-ray structure of the pglf udp-n-acetylglucosamine 4,6-dehydratase from campylobacterjejuni, d396n/k397a variant in complex with udp-n- acrtylglucosamine (see paper)
32% identity, 87% coverage: 2:305/349 of query aligns to 20:317/339 of 5bjvA
- binding nicotinamide-adenine-dinucleotide: G31 (= G13), G34 (= G16), T35 (≠ S17), I36 (≠ F18), D56 (≠ S38), H57 (≠ R39), S82 (≠ F65), I83 (= I66), A104 (= A88), A105 (= A89), A106 (= A90), K108 (= K92), N123 (≠ T107), I146 (≠ L130), K162 (= K146), F184 (≠ Y170), G185 (= G171), N186 (= N172), V187 (= V173), S190 (= S176), S191 (≠ R177)
- binding uridine-diphosphate-n-acetylglucosamine: K108 (= K92), H109 (≠ Q93), T148 (= T132), G185 (= G171), N186 (= N172), S193 (= S179), V194 (= V180), T209 (= T195), L210 (= L196), T211 (= T197), I215 (≠ M201), R217 (= R203), R276 (= R261), E279 (= E264)
3pvzA Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
26% identity, 66% coverage: 2:231/349 of query aligns to 26:255/372 of 3pvzA
- binding nicotinamide-adenine-dinucleotide: G40 (= G16), S41 (= S17), I42 (≠ F18), D62 (≠ S38), I63 (≠ R39), D92 (= D68), I93 (≠ V69), L114 (≠ A88), S115 (≠ A89), A116 (= A90), K118 (= K92), V158 (≠ L130), D161 (= D133), K174 (= K146), V198 (= V173), S201 (= S176)
3pvzB Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
26% identity, 72% coverage: 2:251/349 of query aligns to 24:264/300 of 3pvzB
- binding nicotinamide-adenine-dinucleotide: G38 (= G16), S39 (= S17), I40 (≠ F18), D60 (≠ S38), I61 (≠ R39), L89 (≠ G67), D90 (= D68), I91 (≠ V69), L112 (≠ A88), S113 (≠ A89), A114 (= A90), K116 (= K92), D159 (= D133), K172 (= K146), N195 (= N172), V196 (= V173), S199 (= S176)
1sb8A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-n-acetylgalactosamine (see paper)
29% identity, 62% coverage: 7:222/349 of query aligns to 17:253/341 of 1sb8A
- active site: S142 (≠ T132), S143 (vs. gap), S144 (vs. gap), Y166 (≠ M142), K170 (= K146), N204 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G23 (= G13), G26 (= G16), F27 (≠ S17), I28 (≠ F18), D47 (≠ I34), N48 (≠ R35), F49 (≠ I36), T51 (≠ S38), G52 (≠ R39), D78 (= D68), I79 (≠ V69), Q98 (≠ A88), A100 (= A90), T117 (= T107), A140 (≠ L130), A141 (≠ S131), Y166 (≠ M142), K170 (= K146), Y193 (= Y170), N195 (= N172), V196 (= V173)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (≠ Q93), S142 (≠ T132), S143 (vs. gap), S144 (vs. gap), Y166 (≠ M142), N195 (= N172), A209 (≠ S179), V210 (= V180), W214 (= W184), Y225 (≠ T195), I226 (≠ L196), N227 (≠ T197), R234 (= R203)
Sites not aligning to the query:
1sb9A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-glucose (see paper)
29% identity, 62% coverage: 7:222/349 of query aligns to 16:252/340 of 1sb9A
- active site: S141 (≠ T132), S142 (vs. gap), S143 (vs. gap), Y165 (≠ M142), K169 (= K146), N203 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G22 (= G13), G25 (= G16), F26 (≠ S17), I27 (≠ F18), D46 (≠ I34), N47 (≠ R35), F48 (≠ I36), T50 (≠ S38), G51 (≠ R39), D77 (= D68), I78 (≠ V69), Q97 (≠ A88), A99 (= A90), T116 (= T107), A139 (≠ L130), A140 (≠ S131), Y165 (≠ M142), K169 (= K146), Y192 (= Y170), N194 (= N172), V195 (= V173)
- binding uridine-5'-diphosphate-glucose: S141 (≠ T132), Y165 (≠ M142), N194 (= N172), A208 (≠ S179), V209 (= V180), W213 (= W184), Y224 (≠ T195), I225 (≠ L196), N226 (≠ T197)
Sites not aligning to the query:
Q7BJX9 UDP-N-acetylglucosamine 4-epimerase; UDP-GalNAc 4-epimerase; EC 5.1.3.7 from Plesiomonas shigelloides (Aeromonas shigelloides) (see 2 papers)
28% identity, 56% coverage: 3:196/349 of query aligns to 16:229/345 of Q7BJX9
Sites not aligning to the query:
- 228:230 binding
- 236 S→G: No effect on epimerase activity.
- 237 binding
- 271 R→G: No effect on epimerase activity.
- 302:305 binding
- 307 R→A: No effect on epimerase activity.
- 308 H→A: No effect on epimerase activity.
- 309 S→Y: Abolishes epimerase activity.
Query Sequence
>349909 FitnessBrowser__Btheta:349909
MSIFAGKTLMITGGTGSFGNAVLNRFLRTDIGEIRIFSRDEKKQDDMRHEYQVKYPDVAH
KIKFFIGDVRNLQSCKNAMPGVDYIFHAAALKQVPSCEFFPMEAVKTNVIGTDNVLTAAI
EAGVGAVICLSTDKAAYPINAMGITKAVEEKIAVAKSRYSGKTKICCTRYGNVMCSRGSV
IPLWIEQIRNGNPVTLTEPTMTRFIMSLEEAVDLVLFAFEHGQNGDILVQKAPACTIQTQ
AEAVCELFGGKKEDIKVIGIRHGEKMYETLLTNEECAKAEDMGNFYRVPADNRGLNYDKF
FKEGETERNTLTEFNSNNTYILNVEETKVKIAALDYIQKELSGEGNFVQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory