Comparing 350037 FitnessBrowser__Btheta:350037 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6p6jA Structure of ybtpq importer with substrate ybt-fe bound (see paper)
34% identity, 88% coverage: 67:574/576 of query aligns to 54:569/571 of 6p6jA
2onjA Structure of the multidrug abc transporter sav1866 from s. Aureus in complex with amp-pnp (see paper)
36% identity, 82% coverage: 96:569/576 of query aligns to 97:577/578 of 2onjA
2hydA Multidrug abc transporter sav1866 (see paper)
36% identity, 82% coverage: 96:569/576 of query aligns to 97:577/578 of 2hydA
G7CBF5 Mycobactin import ATP-binding/permease protein IrtA; EC 7.2.2.- from Mycolicibacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316) (Mycobacterium thermoresistibile) (see paper)
35% identity, 90% coverage: 55:572/576 of query aligns to 363:892/908 of G7CBF5
Sites not aligning to the query:
A0R6H8 Mycobactin import ATP-binding/permease protein IrtA; EC 7.2.2.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
35% identity, 90% coverage: 56:572/576 of query aligns to 328:847/860 of A0R6H8
Sites not aligning to the query:
5ochE The crystal structure of human abcb8 in an outward-facing state
36% identity, 82% coverage: 91:564/576 of query aligns to 83:566/576 of 5ochE
Q9NUT2 Mitochondrial potassium channel ATP-binding subunit; ATP-binding cassette sub-family B member 8, mitochondrial; ABCB8; Mitochondrial ATP-binding cassette 1; M-ABC1; Mitochondrial sulfonylurea-receptor; MITOSUR from Homo sapiens (Human) (see 4 papers)
36% identity, 82% coverage: 91:564/576 of query aligns to 223:706/735 of Q9NUT2
Sites not aligning to the query:
7wixA Cryo-em structure of mycobacterium tuberculosis irtab in complex with adp
36% identity, 80% coverage: 108:566/576 of query aligns to 104:567/571 of 7wixA
7wivA Cryo-em structure of mycobacterium tuberculosis irtab in complex with an amp-pnp
36% identity, 80% coverage: 108:566/576 of query aligns to 104:567/571 of 7wivA
P9WQJ9 Mycobactin import ATP-binding/permease protein IrtA; Iron-regulated transporter A; EC 7.2.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 80% coverage: 108:566/576 of query aligns to 379:842/859 of P9WQJ9
Sites not aligning to the query:
7wixB Cryo-em structure of mycobacterium tuberculosis irtab in complex with adp
35% identity, 76% coverage: 141:576/576 of query aligns to 132:573/576 of 7wixB
7wiwA Cryo-em structure of mycobacterium tuberculosis irtab complexed with atp in an occluded conformation
36% identity, 80% coverage: 108:566/576 of query aligns to 104:567/570 of 7wiwA
Sites not aligning to the query:
Q9DC29 ATP-binding cassette sub-family B member 6; ABC-type heme transporter ABCB6; EC 7.6.2.5 from Mus musculus (Mouse) (see paper)
43% identity, 53% coverage: 267:570/576 of query aligns to 518:827/842 of Q9DC29
Sites not aligning to the query:
6qexA Nanodisc reconstituted human abcb1 in complex with uic2 fab and taxol (see paper)
33% identity, 81% coverage: 108:576/576 of query aligns to 129:606/1182 of 6qexA
Sites not aligning to the query:
7o9wA Encequidar-bound human p-glycoprotein in complex with uic2-fab (see paper)
33% identity, 81% coverage: 108:576/576 of query aligns to 116:593/1169 of 7o9wA
Sites not aligning to the query:
7a6fA Nanodisc reconstituted human abcb1 in complex with mrk16 fab and zosuquidar (see paper)
33% identity, 81% coverage: 108:576/576 of query aligns to 111:588/1164 of 7a6fA
Sites not aligning to the query:
7a6eA Nanodisc reconstituted human abcb1 in complex with mrk16 fab and tariquidar (see paper)
33% identity, 81% coverage: 108:576/576 of query aligns to 111:588/1164 of 7a6eA
Sites not aligning to the query:
7a6cA Nanodisc reconstituted human abcb1 in complex with mrk16 fab and elacridar (see paper)
33% identity, 81% coverage: 108:576/576 of query aligns to 111:588/1164 of 7a6cA
Sites not aligning to the query:
7a69A Nanodisc reconstituted human abcb1 in complex with mrk16 fab and vincristine (see paper)
33% identity, 81% coverage: 108:576/576 of query aligns to 111:588/1164 of 7a69A
Sites not aligning to the query:
6fn1A Zosuquidar and uic2 fab complex of human-mouse chimeric abcb1 (abcb1hm) (see paper)
33% identity, 81% coverage: 108:576/576 of query aligns to 129:606/1182 of 6fn1A
Sites not aligning to the query:
>350037 FitnessBrowser__Btheta:350037
MNAIKNITVGHTERLRKPVGYTMLANLVNIVPFCLSIEAINVIFRTFDGSGTPLDTNRLW
MIFAILVVYMVVMAFAERAAYRANFRGAYEMSAEGRINLAEHLRKLSLGFLSRRDPGDLS
SMLITDFTMAETGISHHLPQLMGALVMPVFAFLGLLWIDWRMAVAMFVALPLAVAVLLLS
NIAQRKLSVRQIEAKINAGNRLEEYLQGIRVMKAYNLLGGKFERLKMAFSDLRRACIRQE
ALLGPFILFSVTLIRAGLTFMILCGTYLLIGGELSLLTFVMFLVVGSRVFDPLTSALTNF
AEFRYFSIAGGRILTLMNEPEMKGDRDVPESGDITFDHVSFGYQEKEILHDISVTLRKGT
LTALVGPSGSGKSTMLKLCARFYDPRKGSVRFNGMDMKELEPESLMKHCSMVFQDVYLFQ
DTLKNNIRFGRTDATDEEIVAAAKKACCHEFIMRLPKGYDTMVGEGGCTLSGGEKQRISI
ARAMLKEAPVVLLDEATASLDPENEVEVQQAINTLIAGRTVIVIAHRLKTIRNADRIIVL
EEGRIAEQGTHDELLSRPGLYAKLWNIQEQTSGWKL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory