Comparing 350803 FitnessBrowser__Btheta:350803 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
P32171 L-Rhamnulokinase; RhaB; RhuK; ATP:L-rhamnulose phosphotransferase; L-rhamnulose 1-kinase; Rhamnulose kinase; EC 2.7.1.5 from Escherichia coli (strain K12) (see paper)
40% identity, 99% coverage: 4:474/476 of query aligns to 2:465/489 of P32171
2uytA Structure of l-rhamnulose kinase in complex with adp and beta-l- rhamnulose. (see paper)
39% identity, 99% coverage: 4:474/476 of query aligns to 1:464/479 of 2uytA
2cglA Crystal structure of l-rhamnulose kinase from escherichia coli in complex with l-fructose, adp and a modeled atp gamma phosphate. (see paper)
39% identity, 99% coverage: 4:474/476 of query aligns to 1:464/479 of 2cglA
2cgjA Crystal structure of l-rhamnulose kinase from escherichia coli in complex with l-fructose and adp. (see paper)
39% identity, 99% coverage: 4:474/476 of query aligns to 1:464/479 of 2cgjA
Q1R415 Rhamnulokinase; Rhamnulose kinase; EC 2.7.1.5 from Escherichia coli (strain UTI89 / UPEC) (see paper)
38% identity, 99% coverage: 4:474/476 of query aligns to 2:465/489 of Q1R415
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
20% identity, 74% coverage: 121:474/476 of query aligns to 115:460/490 of 3ll3B
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
20% identity, 74% coverage: 121:474/476 of query aligns to 116:462/492 of 3ll3A
Sites not aligning to the query:
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
23% identity, 74% coverage: 125:476/476 of query aligns to 118:468/478 of 5ya2A
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
24% identity, 74% coverage: 125:476/476 of query aligns to 118:468/478 of 5ya1A
5htxA Putative sugar kinases from arabidopsis thaliana in complex with adp (see paper)
23% identity, 89% coverage: 9:430/476 of query aligns to 4:400/424 of 5htxA
5htvA Putative sugar kinases from arabidopsis thaliana in complex with amppnp (see paper)
23% identity, 89% coverage: 9:430/476 of query aligns to 4:400/424 of 5htvA
Q8L794 D-ribulose kinase; D-ribulokinase; Inactive Xylulose kinase 1; Atxk-1; EC 2.7.1.47 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
23% identity, 89% coverage: 9:430/476 of query aligns to 56:452/478 of Q8L794
>350803 FitnessBrowser__Btheta:350803
MKDTTRNTYLAVDFGGGSGRVIAGSLLQGKLELEEIHRFTNRQVKLGNHVYWDFPALFED
MKTGLKLAAQKGYHVKGIGIDTWGVDFGLIDKKGNLLGNPVCYRDARTDGMPDKVFQILD
AQKHYACTGIQVMPINTLFQLYSMQQNQDVLLEVAQRLLFMPDLFSYYLTGVANNEYCIA
STSELLDARQRNWSMDTIRALGLPEHLFGEIILPGTVRGTLKEEIGRETGLGPVDIIAVG
SHDTASAVAAVPATEGQVAFLSSGTWSLLGVEVDEPILTEEARLAQFTNEGGVGGHIRFL
QNITGLWILQRLMSEWKLRGEEQSYDTILPQAADAEIDTIIPVDDAEFMNPENMETALLN
YCRNHSLKVPGNKAEMVKCVLQSLAFKYREAVAQLNRCLPSPIHRLNIIGGGSQNKLLNQ
LTANALGIPVYAGPVEATAMGNILTQAMAKGEISSLREIREVVSHSVTPQVYYPEK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory