SitesBLAST
Comparing 350898 FitnessBrowser__Btheta:350898 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7cgvA Full consensus l-threonine 3-dehydrogenase, fctdh-iiym (NAD+ bound form) (see paper)
57% identity, 98% coverage: 2:312/318 of query aligns to 1:307/310 of 7cgvA
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Q11 (= Q12), I12 (= I13), D33 (≠ Y34), I34 (= I35), R35 (≠ Q36), L48 (≠ V53), D49 (= D54), V50 (= V55), A72 (= A77), A73 (= A78), L75 (= L80), P112 (= P116), S114 (= S118), Y139 (= Y143), K143 (= K147), Y166 (≠ F170), I169 (= I173)
5z75A Artificial l-threonine 3-dehydrogenase designed by ancestral sequence reconstruction. (see paper)
51% identity, 97% coverage: 1:310/318 of query aligns to 2:306/306 of 5z75A
- binding nicotinamide-adenine-dinucleotide: G9 (= G8), C11 (≠ T10), G12 (= G11), Q13 (= Q12), I14 (= I13), D35 (≠ Y34), I36 (= I35), L49 (≠ V53), V51 (= V55), L72 (= L76), A73 (= A77), L76 (= L80), P113 (= P116), S115 (= S118), Y140 (= Y143), K144 (= K147), Y167 (≠ F170), P168 (= P171), L170 (≠ I173), P176 (= P179), P177 (= P180)
7eprB Partial consensus l-threonine 3-dehydrogenase (c-change) (see paper)
48% identity, 98% coverage: 2:313/318 of query aligns to 2:309/310 of 7eprB
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), Q12 (= Q12), I13 (= I13), D34 (≠ Y34), I35 (= I35), R36 (≠ Q36), D50 (= D54), A51 (≠ V55), L72 (= L76), A73 (= A77), A74 (= A78), L90 (≠ I94), P113 (= P116), Y140 (= Y143), K144 (= K147), Y167 (≠ F170), L170 (≠ I173)
7epsA Partial consensus l-threonine 3-dehydrogenase (e-change) (see paper)
48% identity, 97% coverage: 4:313/318 of query aligns to 3:308/310 of 7epsA
- binding nicotinamide-adenine-dinucleotide: N9 (≠ T10), G10 (= G11), Q11 (= Q12), I12 (= I13), D33 (≠ Y34), V34 (≠ I35), L48 (≠ V53), A50 (≠ V55), L71 (= L76), A72 (= A77), A73 (= A78), L89 (≠ I94), P112 (= P116), Y139 (= Y143), K143 (= K147), Y166 (≠ F170), L169 (≠ I173)
- binding threonine: S76 (= S81), S114 (= S118), Y139 (= Y143), G179 (= G183), T180 (= T184), T181 (= T185)
2yy7A Crystal structure of thermolabile l-threonine dehydrogenase from flavobacterium frigidimaris kuc-1 (see paper)
49% identity, 97% coverage: 4:312/318 of query aligns to 5:311/312 of 2yy7A
- binding glycerol: S118 (= S118), Y143 (= Y143), G183 (= G183), T184 (= T184), T185 (= T185), W279 (= W280)
- binding nicotinamide-adenine-dinucleotide: C11 (≠ T10), G12 (= G11), Q13 (= Q12), I14 (= I13), D35 (≠ Y34), I36 (= I35), R37 (≠ Q36), V52 (= V53), N53 (≠ D54), A54 (≠ V55), M75 (≠ L76), A76 (= A77), L93 (≠ I94), P116 (= P116), S118 (= S118), Y143 (= Y143), K147 (= K147), Y170 (≠ F170), L173 (≠ I173)
3a1nA Crystal structure of l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
44% identity, 98% coverage: 4:316/318 of query aligns to 2:309/315 of 3a1nA
- active site: T112 (≠ S118), Y137 (= Y143), K141 (= K147)
- binding nicotinamide-adenine-dinucleotide: S8 (≠ T10), G9 (= G11), Q10 (= Q12), I11 (= I13), D32 (≠ Y34), I33 (= I35), L46 (≠ V53), D47 (= D54), L69 (= L76), A70 (= A77), G71 (≠ A78), L73 (= L80), S111 (= S117), Y137 (= Y143), K141 (= K147), Y164 (≠ F170)
3a4vA Crystal structure of pyruvate bound l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
44% identity, 98% coverage: 4:316/318 of query aligns to 2:309/311 of 3a4vA
- active site: T112 (≠ S118), Y137 (= Y143), K141 (= K147)
- binding nicotinamide-adenine-dinucleotide: S8 (≠ T10), G9 (= G11), Q10 (= Q12), I11 (= I13), D32 (≠ Y34), I33 (= I35), L46 (≠ V53), D47 (= D54), V48 (= V55), L69 (= L76), A70 (= A77), G71 (≠ A78), L73 (= L80), P110 (= P116), S111 (= S117), T112 (≠ S118), Y137 (= Y143), K141 (= K147), Y164 (≠ F170), I167 (= I173)
- binding pyruvic acid: S74 (= S81), Y137 (= Y143), T178 (= T184), T179 (= T185), W273 (= W280)
6jygD Crystal structure of l-threonine dehydrogenase from phytophthora infestans (see paper)
44% identity, 99% coverage: 3:316/318 of query aligns to 2:307/307 of 6jygD
- binding citrate anion: Q11 (= Q12), L73 (= L80), S74 (= S81), Y136 (= Y143), G176 (= G183), T178 (= T185), D179 (= D186)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), T9 (= T10), G10 (= G11), Q11 (= Q12), I12 (= I13), D33 (≠ Y34), I34 (= I35), K35 (≠ Q36), D47 (= D54), V48 (= V55), M69 (≠ L76), A70 (= A77), S71 (≠ A78), L73 (= L80), V87 (≠ I94), P109 (= P116), S110 (= S117), T111 (≠ S118), Y136 (= Y143), K140 (= K147), Y163 (≠ F170), V166 (≠ I173)
3ajrA Crystal structure of l-3-hydroxynorvaline bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
44% identity, 98% coverage: 4:316/318 of query aligns to 2:309/314 of 3ajrA
- binding nicotinamide-adenine-dinucleotide: S8 (≠ T10), G9 (= G11), Q10 (= Q12), I11 (= I13), D32 (≠ Y34), I33 (= I35), L46 (≠ V53), D47 (= D54), V48 (= V55), L69 (= L76), A70 (= A77), G71 (≠ A78), L73 (= L80), P110 (= P116), S111 (= S117), T112 (≠ S118), F137 (≠ Y143), K141 (= K147), Y164 (≠ F170), I167 (= I173)
- binding (3R)-3-hydroxy-L-norvaline: S74 (= S81), T112 (≠ S118), I113 (= I119), F137 (≠ Y143), G177 (= G183), T178 (= T184), T179 (= T185)
3a9wA Crystal structure of l-threonine bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
44% identity, 98% coverage: 4:316/318 of query aligns to 2:309/315 of 3a9wA
- binding nicotinamide-adenine-dinucleotide: S8 (≠ T10), G9 (= G11), Q10 (= Q12), I11 (= I13), D32 (≠ Y34), I33 (= I35), L46 (≠ V53), D47 (= D54), V48 (= V55), L69 (= L76), A70 (= A77), L73 (= L80), V87 (≠ I94), P110 (= P116), S111 (= S117), K141 (= K147), Y164 (≠ F170), I167 (= I173)
- binding threonine: S74 (= S81), T112 (≠ S118), F137 (≠ Y143), G177 (= G183), T178 (= T184), T179 (= T185)
3wmwB Gale-like l-threonine dehydrogenase from cupriavidus necator (apo form) (see paper)
46% identity, 97% coverage: 4:313/318 of query aligns to 4:278/278 of 3wmwB
Q8K3F7 L-threonine 3-dehydrogenase, mitochondrial; EC 1.1.1.103 from Mus musculus (Mouse) (see paper)
44% identity, 91% coverage: 21:310/318 of query aligns to 75:361/373 of Q8K3F7
- DIR 88:90 (≠ YIQ 34:36) binding
- NI 106:107 (≠ DV 54:55) binding
- S133 (= S81) mutation to A: Decreased L-threonine 3-dehydrogenase activity.
- R180 (≠ H128) mutation to K: Decreased L-threonine 3-dehydrogenase activity. No effect on protein NAD(+)-binding. No gross effect on protein folding. No effect on protein stability.
- Y195 (= Y143) binding
- K199 (= K147) binding
- I225 (= I173) binding
- T237 (= T185) mutation to A: Decreased L-threonine 3-dehydrogenase activity.
- M333 (≠ D282) mutation to A: Decreased L-threonine 3-dehydrogenase activity.; mutation to E: Decreased L-threonine 3-dehydrogenase activity. Decreased affinity for L-threonine.
Sites not aligning to the query:
4yr9A Mouse tdh with NAD+ bound (see paper)
44% identity, 91% coverage: 21:310/318 of query aligns to 21:306/308 of 4yr9A
- binding glycerol: Y141 (= Y143), T182 (= T185), W276 (= W280)
- binding nicotinamide-adenine-dinucleotide: D34 (≠ Y34), I35 (= I35), R36 (≠ Q36), A51 (≠ V53), N52 (≠ D54), I53 (≠ V55), Y74 (≠ L76), S75 (≠ A77), A76 (= A78), L78 (= L80), P114 (= P116), T116 (≠ S118), Y141 (= Y143), K145 (= K147), Y168 (≠ F170), I171 (= I173)
Sites not aligning to the query:
5y1gA Monomeric l-threonine 3-dehydrogenase from metagenome database (akb and nadh bound form) (see paper)
40% identity, 97% coverage: 4:313/318 of query aligns to 4:306/310 of 5y1gA
- binding 2-amino-3-ketobutyric acid: S76 (= S81), G178 (= G183), T179 (= T184), T180 (= T185), W273 (= W280)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), Q12 (= Q12), I13 (= I13), D34 (≠ Y34), L35 (≠ I35), D49 (≠ A51), I50 (≠ V52), L71 (= L76), A72 (= A77), A73 (= A78), L75 (= L80), Y138 (= Y143), K142 (= K147), Y165 (≠ F170), L168 (≠ I173)
5y1eA Monomeric l-threonine 3-dehydrogenase from metagenome database (l-ser and NAD+ bound form) (see paper)
40% identity, 97% coverage: 4:313/318 of query aligns to 2:304/308 of 5y1eA
- binding nicotinamide-adenine-dinucleotide: G6 (= G8), G9 (= G11), Q10 (= Q12), I11 (= I13), D32 (≠ Y34), L33 (≠ I35), D47 (≠ A51), I48 (≠ V52), L69 (= L76), A70 (= A77), A71 (= A78), L73 (= L80), P109 (= P116), Y136 (= Y143), K140 (= K147), Y163 (≠ F170), L166 (≠ I173)
- binding serine: S74 (= S81), S111 (= S118), Y136 (= Y143), G176 (= G183), T177 (= T184), T178 (= T185)
5y1fA Monomeric l-threonine 3-dehydrogenase from metagenome database (NAD+ bound form) (see paper)
40% identity, 97% coverage: 4:313/318 of query aligns to 5:307/311 of 5y1fA
- binding nicotinamide-adenine-dinucleotide: G12 (= G11), Q13 (= Q12), I14 (= I13), D35 (≠ Y34), L36 (≠ I35), D50 (≠ A51), I51 (≠ V52), L72 (= L76), A73 (= A77), A74 (= A78), L76 (= L80), S114 (= S118), Y139 (= Y143), K143 (= K147), Y166 (≠ F170), L169 (≠ I173)
5lc1A L-threonine dehydrogenase from trypanosoma brucei with NAD and the inhibitor pyruvate bound. (see paper)
41% identity, 98% coverage: 1:312/318 of query aligns to 1:311/320 of 5lc1A
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), Q12 (= Q12), I13 (= I13), D34 (≠ Y34), V35 (≠ I35), D54 (= D54), C55 (≠ V55), L76 (= L76), P77 (≠ A77), A78 (= A78), M80 (≠ L80), P116 (= P116), T118 (≠ S118), Y143 (= Y143), K147 (= K147), L170 (≠ F170), I173 (= I173)
- binding pyruvic acid: S81 (= S81), Y143 (= Y143), G183 (= G183), T185 (= T185), W279 (= W280)
5k4wC Three-dimensional structure of l-threonine 3-dehydrogenase from trypanosoma brucei bound to nadh and l-threonine refined to 1.72 angstroms (see paper)
41% identity, 98% coverage: 1:312/318 of query aligns to 2:312/321 of 5k4wC
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G8), G12 (= G11), Q13 (= Q12), I14 (= I13), D35 (≠ Y34), V36 (≠ I35), D55 (= D54), C56 (≠ V55), L77 (= L76), P78 (≠ A77), A79 (= A78), M81 (≠ L80), P117 (= P116), Y144 (= Y143), K148 (= K147), L171 (≠ F170), I174 (= I173)
- binding threonine: M81 (≠ L80), S82 (= S81), T119 (≠ S118), Y144 (= Y143), G184 (= G183), A185 (≠ T184), T186 (= T185), W280 (= W280)
5k4qA Three-dimensional structure of l-threonine 3-dehydrogenase from trypanosoma brucei bound to NAD+ refined to 2.3 angstroms (see paper)
41% identity, 98% coverage: 1:312/318 of query aligns to 1:311/320 of 5k4qA
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), L10 (≠ T10), G11 (= G11), Q12 (= Q12), I13 (= I13), D34 (≠ Y34), V35 (≠ I35), C55 (≠ V55), L76 (= L76), P77 (≠ A77), A78 (= A78), M80 (≠ L80), P116 (= P116), S117 (= S117), Y143 (= Y143), K147 (= K147), L170 (≠ F170), I173 (= I173)
5k50C Three-dimensional structure of l-threonine 3-dehydrogenase from trypanosoma brucei bound to NAD+ and l-allo-threonine refined to 2.23 angstroms (see paper)
41% identity, 97% coverage: 3:312/318 of query aligns to 2:310/319 of 5k50C
- binding allo-threonine: M79 (≠ L80), S80 (= S81), T117 (≠ S118), Y142 (= Y143), A183 (≠ T184), W278 (= W280)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Q11 (= Q12), I12 (= I13), D33 (≠ Y34), V34 (≠ I35), D53 (= D54), C54 (≠ V55), L75 (= L76), P76 (≠ A77), A77 (= A78), M79 (≠ L80), T117 (≠ S118), Y142 (= Y143), K146 (= K147), L169 (≠ F170), P170 (= P171), I172 (= I173)
Query Sequence
>350898 FitnessBrowser__Btheta:350898
MKHILIIGATGQIGSELTMELRRRYGNTNVVAGYIQGAEPKGELKESGPSAVVDVTNGEM
IESVVKEYHIDTIYNLAALLSVVAESKPKLAWKIGIDGLWNVLEVAREQGCAVFTPSSIG
SFGASTPHTQTPQDTIQRPRTMYGVTKVTTELLSDYYFNKYGVDTRAVRFPGIISNVTPP
GGGTTDYAVDIYYSAVRGEKFVCPIKEGTLMDMMYMPDALNAAIMLMEADPTKLIHRNAF
NIASMSFDPETIFHAIKKHVPAFEMIYDVDPLKQRIADSWPDSLDDTCAREEWGWKPAYD
LESMTVDMLEKLREKLKK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory