Comparing 351285 FitnessBrowser__Btheta:351285 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
26% identity, 95% coverage: 9:287/295 of query aligns to 8:296/306 of 5eynA
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
27% identity, 86% coverage: 3:256/295 of query aligns to 1:256/304 of 3ih0A
Sites not aligning to the query:
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
28% identity, 86% coverage: 4:256/295 of query aligns to 1:255/302 of 3gbuA
Sites not aligning to the query:
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
26% identity, 95% coverage: 9:287/295 of query aligns to 12:300/310 of 5yggA
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
27% identity, 90% coverage: 23:287/295 of query aligns to 39:300/313 of 6ilsB
Sites not aligning to the query:
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 90% coverage: 23:287/295 of query aligns to 105:366/379 of A1A6H3
Sites not aligning to the query:
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
25% identity, 97% coverage: 1:287/295 of query aligns to 4:298/319 of Q8ZKR2
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
24% identity, 97% coverage: 3:287/295 of query aligns to 1:287/299 of 1tz3A
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
24% identity, 95% coverage: 4:284/295 of query aligns to 7:306/312 of 4wjmA
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
24% identity, 97% coverage: 3:287/295 of query aligns to 1:287/297 of 1tz6A
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
23% identity, 89% coverage: 20:281/295 of query aligns to 29:292/311 of 2varA
Sites not aligning to the query:
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
23% identity, 89% coverage: 20:281/295 of query aligns to 30:293/313 of Q97U29
Sites not aligning to the query:
7fcaD Pfkb(mycobacterium marinum) (see paper)
26% identity, 83% coverage: 8:252/295 of query aligns to 7:236/282 of 7fcaD
2fv7A Crystal structure of human ribokinase
27% identity, 78% coverage: 23:252/295 of query aligns to 38:261/308 of 2fv7A
Sites not aligning to the query:
6wk0B Crystal structure of human ribokinase in complex with amppcp and ribose
27% identity, 78% coverage: 23:252/295 of query aligns to 39:262/311 of 6wk0B
Sites not aligning to the query:
5c41A Crystal structure of human ribokinase in complex with amppcp in p21 spacegroup and with 4 protomers
27% identity, 78% coverage: 23:252/295 of query aligns to 39:262/317 of 5c41A
Sites not aligning to the query:
5c3yA Structure of human ribokinase crystallized with amppnp
27% identity, 78% coverage: 23:252/295 of query aligns to 38:261/306 of 5c3yA
Sites not aligning to the query:
Q9H477 Ribokinase; RK; EC 2.7.1.15 from Homo sapiens (Human)
27% identity, 78% coverage: 23:252/295 of query aligns to 52:275/322 of Q9H477
Sites not aligning to the query:
5byfA Crystal structure of human ribokinase in complex with amp
27% identity, 78% coverage: 23:252/295 of query aligns to 40:263/313 of 5byfA
Sites not aligning to the query:
6wjzA Crystal structure of human ribokinase in complex with ampcp
27% identity, 78% coverage: 23:252/295 of query aligns to 39:262/315 of 6wjzA
Sites not aligning to the query:
>351285 FitnessBrowser__Btheta:351285
MNNIIVGMGEALWDVLPEGKKIGGAPANFAYHVSQFGFDSRVVSAVGNDELGDEIMEVFK
EKQLKNQIERVDYPTGTVQVTLDDEGVPCYEIKEGVAWDNIPFTDELKRLALNTRAVCFG
SLAQRNEVSRATINRFLDTMPDIDGQLKIFDINLRQDFYTKEVLRESFKRCNILKINDEE
LVTISRMFGYPGIDLQDKCWILLAKYNLKMLILTCGINGSYVFTPGVVSFQETPKVPVAD
TVGAGDSFTAAFCASILNGKSVPEAHKLAVEVSAYVCTQSGAMPELPVILKDRLL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory