SitesBLAST
Comparing 351507 FitnessBrowser__Btheta:351507 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
8hp3A Crystal structure of meso-diaminopimelate dehydrogenase from prevotella timonensis (see paper)
71% identity, 100% coverage: 2:299/299 of query aligns to 1:298/298 of 8hp3A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G12), N12 (= N13), I13 (= I14), R34 (= R35), R35 (= R36), A66 (≠ C67), T67 (= T68), P68 (= P69), S69 (≠ T70), R70 (= R71), Y75 (= Y76), S89 (= S90), D91 (= D92), D121 (= D122), T256 (= T257)
3wbfA Crystal structure of meso-diaminopimelate dehydrogenase from symbiobacterium thermophilum co-crystallized with NADP+ and dap (see paper)
66% identity, 99% coverage: 3:299/299 of query aligns to 1:297/297 of 3wbfA
- binding 2,6-diaminopimelic acid: D90 (= D92), W119 (= W121), D120 (= D122), F144 (= F146), S149 (= S151), M150 (= M152), G151 (= G153), T169 (= T171), R179 (= R181)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Y9 (= Y11), G10 (= G12), N11 (= N13), V12 (≠ I14), R33 (= R35), R34 (= R36), C65 (= C67), V66 (≠ T68), P67 (= P69), T68 (= T70), S88 (= S90), D90 (= D92), G118 (= G120), D120 (= D122), P121 (= P123), M150 (= M152), G151 (= G153), N251 (= N253), T255 (= T257)
3wbbA Crystal structures of meso-diaminopimelate dehydrogenase from symbiobacterium thermophilum (see paper)
66% identity, 99% coverage: 3:299/299 of query aligns to 1:297/297 of 3wbbA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), Y9 (= Y11), G10 (= G12), N11 (= N13), V12 (≠ I14), R33 (= R35), R34 (= R36), C65 (= C67), V66 (≠ T68), P67 (= P69), T68 (= T70), S88 (= S90), D90 (= D92), G118 (= G120), W119 (= W121), D120 (= D122), P121 (= P123), N251 (= N253), T255 (= T257)
8i7hA Meso-diaminopimelate dehydrogenase
65% identity, 99% coverage: 3:299/299 of query aligns to 2:297/297 of 8i7hA
3wycA Structure of a meso-diaminopimelate dehydrogenase in complex with nadp (see paper)
33% identity, 97% coverage: 3:293/299 of query aligns to 2:319/327 of 3wycA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G10), Y10 (= Y11), G11 (= G12), N12 (= N13), L13 (≠ I14), T34 (≠ R35), R35 (= R36), R36 (≠ N41), C68 (= C67), G69 (≠ T68), G70 (≠ P69), S71 (≠ T70), S91 (= S90), D93 (= D92), W122 (= W121), D123 (= D122), P124 (= P123), N275 (= N253), T279 (= T257)
- binding 2-(2-hydroxy-1,1-dihydroxymethyl-ethylamino)-ethanesulfonic acid: V52 (vs. gap), D53 (vs. gap), Q78 (≠ A77), Y81 (= Y80), W122 (= W121), D123 (= D122), W147 (≠ F146), S152 (= S151), T172 (= T171), R198 (= R181), H248 (= H227)
3wgqA Crystal structure of meso-dapdh q154l/t173i/r199m/p248s/h249n/n276s mutant with dap of from clostridium tetani e88
31% identity, 97% coverage: 3:293/299 of query aligns to 1:317/323 of 3wgqA
3wgzB Crystal structure of meso-dapdh q154l/t173i/r199m/p248s/h249n/n276s mutant with d-leucine of from clostridium tetani e88
31% identity, 97% coverage: 3:293/299 of query aligns to 2:318/324 of 3wgzB
3wgyB Crystal structure of meso-dapdh q154l/t173i/r199m/p248s/h249n/n276s mutant with 4-methyl-2-oxovalerate of from clostridium tetani e88
31% identity, 97% coverage: 3:293/299 of query aligns to 2:318/324 of 3wgyB
3dapB C. Glutamicum dap dehydrogenase in complex with NADP+ and the inhibitor 5s-isoxazoline (see paper)
30% identity, 99% coverage: 1:295/299 of query aligns to 1:316/320 of 3dapB
- binding (2s,5',s)-2-amino-3-(3-carboxy-2-isoxazolin-5-yl)propanoic acid: D90 (= D92), W119 (= W121), D120 (= D122), W144 (≠ F146), S149 (= S151), Q150 (≠ M152), G151 (= G153), T169 (= T171), R195 (= R181), H244 (= H227)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G10 (= G10), G12 (= G12), N13 (= N13), L14 (≠ I14), S35 (≠ R35), R36 (= R36), R37 (≠ A37), G67 (≠ P69), S68 (≠ T70), T88 (≠ S90), D90 (= D92), W119 (= W121), D120 (= D122), P121 (= P123), Q150 (≠ M152), G151 (= G153), R157 (≠ K159), T274 (= T257)
2dapA C. Glutamicum dap dehydrogenase in complex with dap (see paper)
30% identity, 99% coverage: 1:295/299 of query aligns to 1:316/320 of 2dapA
1f06B Three dimensional structure of the ternary complex of corynebacterium glutamicum diaminopimelate dehydrogenase NADPH-l-2-amino-6-methylene- pimelate (see paper)
30% identity, 99% coverage: 1:295/299 of query aligns to 1:316/320 of 1f06B
- binding l-2-amino-6-methylene-pimelic acid: D90 (= D92), W119 (= W121), W144 (≠ F146), S149 (= S151), Q150 (≠ M152), G151 (= G153), H152 (= H154), T169 (= T171), R195 (= R181), H244 (= H227), N270 (= N253)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G10 (= G10), G12 (= G12), N13 (= N13), L14 (≠ I14), S35 (≠ R35), R36 (= R36), R37 (≠ A37), C65 (= C67), S68 (≠ T70), T88 (≠ S90), D90 (= D92), T117 (≠ A119), G118 (= G120), W119 (= W121), Q150 (≠ M152), G151 (= G153), T274 (= T257)
1dapB C. Glutamicum dap dehydrogenase in complex with NADP+ (see paper)
30% identity, 99% coverage: 1:295/299 of query aligns to 1:316/320 of 1dapB
- binding acetate ion: W144 (≠ F146), T169 (= T171), R195 (= R181), H244 (= H227)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G10 (= G10), Y11 (= Y11), G12 (= G12), N13 (= N13), L14 (≠ I14), S35 (≠ R35), R36 (= R36), R37 (≠ A37), S68 (≠ T70), T88 (≠ S90), D90 (= D92), T117 (≠ A119), G118 (= G120), W119 (= W121), D120 (= D122), P121 (= P123), Q150 (≠ M152), G151 (= G153), T274 (= T257)
1dapA C. Glutamicum dap dehydrogenase in complex with NADP+ (see paper)
30% identity, 99% coverage: 1:295/299 of query aligns to 1:316/320 of 1dapA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G10 (= G10), Y11 (= Y11), G12 (= G12), N13 (= N13), L14 (≠ I14), S35 (≠ R35), R36 (= R36), R37 (≠ A37), C65 (= C67), M66 (≠ T68), S68 (≠ T70), T88 (≠ S90), D90 (= D92), G118 (= G120), W119 (= W121), D120 (= D122), P121 (= P123), N270 (= N253), T274 (= T257)
5gz6A Structure of d-amino acid dehydrogenase in complex with NADPH and 2- keto-6-aminocapronic acid (see paper)
31% identity, 97% coverage: 3:293/299 of query aligns to 2:312/318 of 5gz6A
- binding 6-azanyl-2-oxidanylidene-hexanoic acid: W147 (≠ F146), K149 (≠ P148)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G10), Y10 (= Y11), G11 (= G12), N12 (= N13), L13 (≠ I14), T34 (≠ R35), R35 (= R36), R36 (≠ N41), G69 (≠ T68), G70 (≠ P69), S71 (≠ T70), S91 (= S90), A93 (≠ D92), G121 (= G120), W122 (= W121), D123 (= D122), P124 (= P123), T272 (= T257)
5loaA Crystal structure of the engineered d-amino acid dehydrogenase (daadh) bound to NADP+
28% identity, 98% coverage: 3:295/299 of query aligns to 2:315/319 of 5loaA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G10), Y10 (= Y11), G11 (= G12), N12 (= N13), L13 (≠ I14), S34 (≠ R35), R35 (= R36), R36 (≠ A37), C64 (= C67), S67 (≠ T70), T87 (≠ S90), D89 (= D92), W118 (= W121), D119 (= D122), P120 (= P123), N269 (= N253), T273 (= T257)
Query Sequence
>351507 FitnessBrowser__Btheta:351507
MKKVRAAIVGYGNIGHYVLEALQAAPDFEIAGVVRRAGAENKPEELANYAVVKDIKELEG
VEVAILCTPTRSVEKYAKEYLAMGINTVDSFDIHTGIVDLRRTLDATAKEHKAVSIISAG
WDPGSDSIVRTMLEAIAPKGITYTNFGPGMSMGHTVAVKAIDGVKAALSMTIPTGTGIHR
RMVYIELKDGYKFEEVAAAIKADPYFVNDETHVKLVPSVDALLDMGHGVNLTRKGVSGKT
QNQLFEFNMRINNPALTAQVLVCVARASMKQQPGCYTMVEVPVIDLLPGDREEWIGHLV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory