SitesBLAST
Comparing 351602 FitnessBrowser__Btheta:351602 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P78827 Probable ketol-acid reductoisomerase, mitochondrial; Acetohydroxy-acid reductoisomerase; Alpha-keto-beta-hydroxylacyl reductoisomerase; EC 1.1.1.86 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
57% identity, 97% coverage: 11:359/359 of query aligns to 53:402/404 of P78827
- S261 (= S218) modified: Phosphoserine
7tocA Crystal structure of the mitochondrial ketol-acid reductoisomerase ilvc from candida auris
61% identity, 97% coverage: 11:358/359 of query aligns to 10:358/359 of 7tocA
- binding magnesium ion: K161 (= K161), D219 (= D219), D219 (= D219), E223 (= E223)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G48 (= G49), G50 (= G51), S51 (≠ V52), Q52 (= Q53), R72 (= R73), S77 (≠ T77), L108 (= L108), L109 (= L109), S110 (= S110), D111 (= D111), A113 (= A113), E116 (≠ S116), H135 (= H135), G162 (= G162), S163 (= S163), S281 (= S281), T282 (= T282), Y328 (= Y328), R329 (= R329)
C8WR67 Ketol-acid reductoisomerase (NADP(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.86 from Alicyclobacillus acidocaldarius subsp. acidocaldarius (strain ATCC 27009 / DSM 446 / BCRC 14685 / JCM 5260 / KCTC 1825 / NBRC 15652 / NCIMB 11725 / NRRL B-14509 / 104-IA) (Bacillus acidocaldarius) (see paper)
42% identity, 69% coverage: 40:287/359 of query aligns to 15:257/344 of C8WR67
- YGSQ 25:28 (≠ YGVQ 50:53) binding
- R48 (= R73) binding ; mutation to P: Inversion of the cofactor specificity from NADPH to NADH.
- S52 (≠ T77) binding ; mutation to D: Inversion of the cofactor specificity from NADPH to NADH.
- DERQ 82:85 (≠ DAAV 111:114) binding
- G133 (= G164) binding
- D190 (= D219) binding
- E194 (= E223) binding
- E226 (= E255) binding
4tskA Ketol-acid reductoisomerase from alicyclobacillus acidocaldarius (see paper)
42% identity, 69% coverage: 40:287/359 of query aligns to 14:256/333 of 4tskA
- active site: K129 (= K161), D189 (= D219), E193 (= E223)
- binding magnesium ion: D189 (= D219), D189 (= D219), E193 (= E223), E193 (= E223), R246 (≠ Y277), Y247 (≠ A278), I249 (≠ C280), D251 (≠ T282), Q254 (= Q285)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y50), G25 (= G51), S26 (≠ V52), Q27 (= Q53), L46 (≠ Q72), R47 (= R73), S51 (≠ T77), L78 (= L108), L79 (= L109), P80 (≠ S110), D81 (= D111), H106 (= H135), P131 (≠ S163)
7q03A Ketol-acid reductoisomerase from methanothermococcus thermolithotrophicus in the close state with NADP and mg2+ (see paper)
41% identity, 70% coverage: 38:289/359 of query aligns to 12:259/328 of 7q03A
- binding magnesium ion: D190 (= D219), E194 (= E223)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y50), G25 (= G51), S26 (≠ V52), Q27 (= Q53), R47 (= R73), S52 (≠ T77), L79 (= L108), I80 (≠ L109), P81 (≠ S110), D82 (= D111), I84 (≠ A113), H107 (= H135), P132 (≠ S163)
E0SRA9 Ketol-acid reductoisomerase (NAD(P)(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.383 from Ignisphaera aggregans (strain DSM 17230 / JCM 13409 / AQ1.S1) (see paper)
35% identity, 89% coverage: 38:355/359 of query aligns to 13:322/335 of E0SRA9
5e4rA Crystal structure of domain-duplicated synthetic class ii ketol-acid reductoisomerase 2ia_kari-dd (see paper)
35% identity, 89% coverage: 38:355/359 of query aligns to 12:321/466 of 5e4rA
- active site: K130 (= K161), D190 (= D219), E194 (= E223)
- binding oxo(propan-2-ylamino)acetic acid: P132 (≠ S163), D190 (= D219), E194 (= E223)
- binding magnesium ion: D190 (= D219), E194 (= E223)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G25 (= G51), S26 (≠ V52), Q27 (= Q53), S52 (≠ T77), L79 (= L108), V80 (≠ L109), P81 (≠ S110), D82 (= D111), V84 (≠ A113), A106 (≠ S134), H107 (= H135), P132 (≠ S163)
Sites not aligning to the query:
4xdzA Holo structure of ketol-acid reductoisomerase from ignisphaera aggregans (see paper)
35% identity, 89% coverage: 38:355/359 of query aligns to 12:321/328 of 4xdzA
- active site: K130 (= K161), D190 (= D219), E194 (= E223)
- binding oxo(propan-2-ylamino)acetic acid: P132 (≠ S163), D190 (= D219), E194 (= E223), L198 (= L227), E230 (= E259), V250 (≠ C280), S251 (= S281), A254 (= A284)
- binding magnesium ion: D190 (= D219), E194 (= E223)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G23 (= G49), G25 (= G51), S26 (≠ V52), Q27 (= Q53), E47 (≠ Q72), R48 (= R73), S52 (≠ T77), L79 (= L108), V80 (≠ L109), P81 (≠ S110), D82 (= D111), V84 (≠ A113), A106 (≠ S134), H107 (= H135), P132 (≠ S163)
6bulB Crystal structure of staphylococcus aureus ketol-acid reductoisomerase with hydroxyoxamate inhibitor 2
36% identity, 89% coverage: 38:355/359 of query aligns to 12:320/327 of 6bulB
- active site: K129 (= K161), D189 (= D219), E193 (= E223)
- binding {hydroxy[(1S)-1-phenylethyl]amino}(oxo)acetic acid: P131 (≠ S163), D189 (= D219), E193 (= E223), E229 (= E259), I233 (≠ L264), I249 (≠ C280), S250 (= S281), A253 (= A284)
- binding oxo{[(1S)-1-phenylethyl]amino}acetic acid: P131 (≠ S163), D189 (= D219), E193 (= E223), E229 (= E259), I233 (≠ L264), I249 (≠ C280), S250 (= S281), A253 (= A284)
- binding magnesium ion: D189 (= D219), E193 (= E223)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y50), G25 (= G51), S26 (≠ V52), Q27 (= Q53), I46 (≠ Q72), R47 (= R73), S51 (≠ T77), L78 (= L108), L79 (= L109), P80 (≠ S110), D81 (= D111), H106 (= H135), P131 (≠ S163), S248 (≠ N279), I249 (≠ C280), S250 (= S281)
6vo2A Crystal structure of staphylococcus aureus ketol-acid reductoisomerase in complex with mg, NADPH and inhibitor. (see paper)
36% identity, 89% coverage: 38:355/359 of query aligns to 12:320/326 of 6vo2A
- binding magnesium ion: D189 (= D219), E193 (= E223)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y50), G25 (= G51), S26 (≠ V52), Q27 (= Q53), I46 (≠ Q72), R47 (= R73), S51 (≠ T77), L78 (= L108), L79 (= L109), P80 (≠ S110), D81 (= D111), H106 (= H135), P131 (≠ S163), I249 (≠ C280), S250 (= S281)
- binding 3-(methylsulfonyl)-2-oxopropanoic acid: G130 (= G162), P131 (≠ S163), D189 (= D219), E193 (= E223), E229 (= E259), I249 (≠ C280), S250 (= S281), A253 (= A284)
6c5nA Crystal structure of staphylococcus aureus ketol-acid reductoisomerase with hydroxyoxamate inhibitor 1
36% identity, 89% coverage: 38:355/359 of query aligns to 12:320/326 of 6c5nA
- active site: K129 (= K161), D189 (= D219), E193 (= E223)
- binding (cyclopentylamino)(oxo)acetic acid: P131 (≠ S163), D189 (= D219), E193 (= E223), C198 (≠ M228), E229 (= E259), I233 (≠ L264), I249 (≠ C280), S250 (= S281), A253 (= A284)
- binding [cyclopentyl(hydroxy)amino](oxo)acetic acid: P131 (≠ S163), D189 (= D219), E193 (= E223), C198 (≠ M228), E229 (= E259), I249 (≠ C280), S250 (= S281), A253 (= A284)
- binding magnesium ion: D189 (= D219), E193 (= E223)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y50), G25 (= G51), S26 (≠ V52), Q27 (= Q53), I46 (≠ Q72), R47 (= R73), S51 (≠ T77), L78 (= L108), L79 (= L109), P80 (≠ S110), D81 (= D111), H106 (= H135), P131 (≠ S163), S248 (≠ N279), I249 (≠ C280), S250 (= S281)
6c55A Crystal structure of staphylococcus aureus ketol-acid reductosimerrase with hydroxyoxamate inhibitor 3
36% identity, 89% coverage: 38:355/359 of query aligns to 12:320/326 of 6c55A
- active site: K129 (= K161), D189 (= D219), E193 (= E223)
- binding [cyclohexyl(hydroxy)amino](oxo)acetic acid: P131 (≠ S163), D189 (= D219), E193 (= E223), C198 (≠ M228)
- binding (cyclohexylamino)(oxo)acetic acid: P131 (≠ S163), D189 (= D219), E193 (= E223), C198 (≠ M228), I249 (≠ C280), S250 (= S281), A253 (= A284)
- binding magnesium ion: D189 (= D219), E193 (= E223)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G25 (= G51), S26 (≠ V52), Q27 (= Q53), I46 (≠ Q72), R47 (= R73), S51 (≠ T77), L79 (= L109), P80 (≠ S110), D81 (= D111), I83 (≠ A113), H106 (= H135), S248 (≠ N279), S250 (= S281)
6aqjA Crystal structures of staphylococcus aureus ketol-acid reductoisomerase in complex with two transition state analogs that have biocidal activity. (see paper)
36% identity, 89% coverage: 38:355/359 of query aligns to 12:320/326 of 6aqjA
- active site: K129 (= K161), D189 (= D219), E193 (= E223)
- binding oxo(propan-2-ylamino)acetic acid: P131 (≠ S163), D189 (= D219), E193 (= E223), E229 (= E259), I233 (≠ L264), I249 (≠ C280), S250 (= S281), A253 (= A284)
- binding n-hydroxy-n-isopropyloxamic acid: P131 (≠ S163), D189 (= D219), E193 (= E223), E229 (= E259), I249 (≠ C280), S250 (= S281), A253 (= A284)
- binding magnesium ion: D189 (= D219), E193 (= E223)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y50), G25 (= G51), S26 (≠ V52), Q27 (= Q53), I46 (≠ Q72), R47 (= R73), S51 (≠ T77), L78 (= L108), L79 (= L109), P80 (≠ S110), D81 (= D111), H106 (= H135), P131 (≠ S163), I249 (≠ C280), S250 (= S281)
5w3kA Crystal structure of staphylococcus aureus ketol-acid reductoisomerase in complex NADPH, mg2+ and cpd (see paper)
36% identity, 89% coverage: 38:355/359 of query aligns to 12:320/326 of 5w3kA
- active site: K129 (= K161), D189 (= D219), E193 (= E223)
- binding cyclopropane-1,1-dicarboxylic acid: D189 (= D219), E193 (= E223), E229 (= E259), I249 (≠ C280), S250 (= S281), A253 (= A284)
- binding magnesium ion: V69 (≠ C99), K70 (≠ E100), A72 (≠ G102), N100 (≠ K129), D189 (= D219), E193 (= E223)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y50), G25 (= G51), S26 (≠ V52), Q27 (= Q53), I46 (≠ Q72), R47 (= R73), S51 (≠ T77), L78 (= L108), L79 (= L109), P80 (≠ S110), D81 (= D111), H106 (= H135), P131 (≠ S163), G132 (= G164), I249 (≠ C280), S250 (= S281)
3fr8B Rice ketolacid reductoisomerase in complex with mg2+-NADPH (see paper)
32% identity, 92% coverage: 28:359/359 of query aligns to 36:380/517 of 3fr8B
- active site: K176 (= K161), D239 (= D219), E243 (= E223)
- binding magnesium ion: H150 (= H135), D239 (= D219), E243 (= E223)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: W57 (≠ Y50), S59 (≠ V52), Q60 (= Q53), R86 (= R73), S89 (vs. gap), L123 (= L108), I124 (≠ L109), S125 (= S110), D126 (= D111), A128 (= A113), S149 (= S134), H150 (= H135), M178 (≠ S163), G179 (= G164)
Sites not aligning to the query:
Q65XK0 Ketol-acid reductoisomerase, chloroplastic; Acetohydroxy-acid reductoisomerase; Alpha-keto-beta-hydroxylacyl reductoisomerase; Protein KARI; EC 1.1.1.86 from Oryza sativa subsp. japonica (Rice) (see paper)
32% identity, 92% coverage: 28:359/359 of query aligns to 94:438/578 of Q65XK0
Q64BR7 Ketol-acid reductoisomerase (NAD(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.382 from Uncultured archaeon GZfos26G2 (see paper)
37% identity, 76% coverage: 39:311/359 of query aligns to 13:284/332 of Q64BR7
4xdyA Structure of nadh-preferring ketol-acid reductoisomerase from an uncultured archean (see paper)
37% identity, 76% coverage: 39:311/359 of query aligns to 13:284/331 of 4xdyA
- active site: K135 (= K161), D195 (= D219), E199 (= E223)
- binding n-hydroxy-n-isopropyloxamic acid: P137 (≠ S163), D195 (= D219), E199 (= E223), E235 (= E259), I239 (≠ L264), I255 (≠ C280), S256 (= S281), A259 (= A284)
- binding magnesium ion: D195 (= D219), E199 (= E223)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G25 (= G51), A26 (≠ V52), Q27 (= Q53), E46 (≠ Q72), L50 (vs. gap), N55 (≠ G75), S57 (≠ T77), L84 (= L108), L85 (= L109), P86 (≠ S110), D87 (= D111), I93 (≠ V117), H112 (= H135), P137 (≠ S163)
Q02138 Ketol-acid reductoisomerase (NADP(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.86 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see paper)
37% identity, 88% coverage: 40:356/359 of query aligns to 16:326/340 of Q02138
- V48 (≠ Q72) mutation to L: Inversion of cofactor specificity from NADPH to NADH. Strong decrease of the affinity for NADPH and 2.5-fold increase of the affinity for NADH. 8-fold decrease of the catalytic efficiency for NADPH and 4-fold increase of the catalytic efficiency for NADH; when associated with P-49, L-52 and D-53.
- R49 (= R73) mutation to P: Inversion of cofactor specificity from NADPH to NADH. Strong decrease of the affinity for NADPH and 2.5-fold increase of the affinity for NADH. 8-fold decrease of the catalytic efficiency for NADPH and 4-fold increase of the catalytic efficiency for NADH; when associated with L-48, L-52 and D-53.
- K52 (= K76) mutation to L: Inversion of cofactor specificity from NADPH to NADH. Strong decrease of the affinity for NADPH and 2.5-fold increase of the affinity for NADH. 8-fold decrease of the catalytic efficiency for NADPH and 4-fold increase of the catalytic efficiency for NADH; when associated with L-48, P-49 and D-53.
- S53 (≠ T77) mutation to D: Inversion of cofactor specificity from NADPH to NADH. Strong decrease of the affinity for NADPH and 2.5-fold increase of the affinity for NADH. 8-fold decrease of the catalytic efficiency for NADPH and 4-fold increase of the catalytic efficiency for NADH; when associated with L-48, P-49 and L-52.
6l2iA Ilvc, a ketol-acid reductoisomerase, from streptococcus pneumoniae_wt
36% identity, 88% coverage: 40:356/359 of query aligns to 14:324/324 of 6l2iA
Query Sequence
>351602 FitnessBrowser__Btheta:351602
MAQVIKTKKQKKMAQLNFGGTVENVVIRDEFPLEKAREVLKNETIAVIGYGVQGPGQALN
LRDNGFNVIVGQRQGKTYDKAVADGWVPGETLFGIEEACEKGTIIMCLLSDAAVMSVWPT
IKPYLTAGKALYFSHGFAITWSDRTGVVPPADIDVIMVAPKGSGTSLRTMFLEGRGLNSS
YAIYQDATGNAMDRTIALGIGIGSGYLFETTFIREATSDLTGERGSLMGAIQGLLLAQYE
VLRENGHTPSEAFNETVEELTQSLMPLFAKNGMDWMYANCSTTAQRGALDWMGPFHDAIK
PVVEKLYHSVKTGNEAQISIDSNSKPDYREKLEEELKALRESEMWQTAVTVRKLRPENN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory