SitesBLAST
Comparing 351958 FitnessBrowser__Btheta:351958 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3hm8A Crystal structure of thE C-terminal hexokinase domain of human hk3
28% identity, 91% coverage: 6:372/402 of query aligns to 12:410/441 of 3hm8A
- active site: R71 (= R64), S131 (= S124), N146 (≠ R139), D185 (= D178)
- binding 6-O-phosphono-beta-D-glucopyranose: D64 (= D57), T68 (= T61), D185 (= D178), T208 (= T202), D389 (≠ E347), T391 (≠ S349)
- binding alpha-D-glucopyranose: S131 (= S124), F132 (≠ Y125), T148 (= T141), K149 (= K142), N184 (= N177), D185 (= D178), N211 (= N205), E236 (= E233), E270 (= E262)
Sites not aligning to the query:
P52790 Hexokinase-3; Hexokinase type III; HK III; Hexokinase-C; EC 2.7.1.1 from Homo sapiens (Human) (see paper)
28% identity, 91% coverage: 6:372/402 of query aligns to 490:888/923 of P52790
- A499 (= A15) to V: in a breast cancer sample; somatic mutation; dbSNP:rs755546220
- TK 626:627 (= TK 141:142) binding
- ND 662:663 (= ND 177:178) binding
- TN 688:689 (= TN 204:205) binding
- E714 (= E233) binding
- E748 (= E262) binding
Sites not aligning to the query:
- 480 R → W: in a colorectal cancer sample; somatic mutation; dbSNP:rs376532514
1bg3A Rat brain hexokinase type i complex with glucose and inhibitor glucose-6-phosphate (see paper)
33% identity, 67% coverage: 6:275/402 of query aligns to 471:746/902 of 1bg3A
- active site: R533 (= R64), S594 (= S124), S609 (≠ R139), D648 (= D178)
- binding beta-D-glucopyranose: F595 (≠ Y125), T611 (= T141), K612 (= K142), N647 (= N177), D648 (= D178), N674 (= N205), E699 (= E233), E733 (= E262)
- binding 6-O-phosphono-alpha-D-glucopyranose: D526 (= D57), G529 (= G60), T530 (= T61), D648 (= D178), G670 (= G201), T671 (= T202)
Sites not aligning to the query:
- binding beta-D-glucopyranose: 149, 150, 166, 167, 202, 203, 229, 254, 288
- binding 6-O-phosphono-alpha-D-glucopyranose: 84, 87, 88, 203, 225, 226, 407, 409, 443, 852, 854, 888
5hg1A Crystal structure of human hexokinase 2 with cmpd 1, a c-2-substituted glucosamine (see paper)
33% identity, 67% coverage: 6:275/402 of query aligns to 434:709/867 of 5hg1A
- active site: R496 (= R64), S557 (= S124), K572 (≠ R139), D611 (= D178)
- binding 2-deoxy-2-{[(2E)-3-(3,4-dichlorophenyl)prop-2-enoyl]amino}-alpha-D-glucopyranose: P559 (= P126), K572 (≠ R139), T574 (= T141), K575 (= K142), N610 (= N177), D611 (= D178), I631 (= I199), G635 (= G203), N637 (= N205), E662 (= E233), N689 (= N255), K692 (= K258), Q693 (= Q259), E696 (= E262)
- binding 6-O-phosphono-beta-D-glucopyranose: D489 (= D57), T493 (= T61), D611 (= D178), T634 (= T202)
Sites not aligning to the query:
P17710 Hexokinase-1; Hexokinase type I; HK I; Hexokinase, tumor isozyme; EC 2.7.1.1 from Mus musculus (Mouse) (see paper)
33% identity, 67% coverage: 6:275/402 of query aligns to 533:811/974 of P17710
Sites not aligning to the query:
- 67 P→A: Disrupts targeting to membrane; when associated with N-68; Q-70; P-73; A-74 and Q-75.
- 68 K→N: Disrupts targeting to membrane; when associated with A-67; Q-70; P-73; A-74 and Q-75.
- 70 R→Q: Disrupts targeting to membrane; when associated with A-67; N-68; P-73; A-74 and Q-75.
- 73 L→P: Disrupts targeting to membrane; when associated with A-67; N-68; Q-70; A-74 and Q-75.
- 74 T→A: Disrupts targeting to membrane; when associated with A-67; N-68; Q-70; P-73 and Q-75.
- 75 E→Q: Disrupts targeting to membrane; when associated with A-67; N-68; Q-70; P-73 and A-74.
P05708 Hexokinase-1; Brain form hexokinase; Hexokinase type I; HK I; Hexokinase-A; EC 2.7.1.1 from Rattus norvegicus (Rat) (see paper)
33% identity, 67% coverage: 6:275/402 of query aligns to 477:755/918 of P05708
Sites not aligning to the query:
- 84:88 binding
- 155 binding
- 172:173 binding
- 208:209 binding
- 209 binding
- 232 binding
- 235 binding
- 260 binding
- 291:294 binding
- 413:415 binding
- 449 binding
- 861:863 binding
- 897 binding
P50521 Hexokinase-2; EC 2.7.1.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
33% identity, 68% coverage: 4:278/402 of query aligns to 14:299/455 of P50521
- N196 (= N177) mutation to S: Decreased affinity for D-glucose.
5hfuB Crystal structure of human hexokinase 2 with cmpd 27, a 2-amido-6- benzenesulfonamide glucosamine (see paper)
29% identity, 86% coverage: 6:351/402 of query aligns to 461:849/897 of 5hfuB
- active site: R523 (= R64), S587 (= S124), K602 (≠ R139), D641 (= D178)
- binding ~{N}-[(2~{S},3~{R},4~{R},5~{S},6~{R})-6-[[(4-cyanophenyl)sulfonylamino]methyl]-2,4,5-tris(oxidanyl)oxan-3-yl]-3-phenyl-benzamide: N640 (= N177), D641 (= D178), G665 (= G203), N667 (= N205), E692 (= E233), E726 (= E262)
Sites not aligning to the query:
- binding ~{N}-[(2~{S},3~{R},4~{R},5~{S},6~{R})-6-[[(4-cyanophenyl)sulfonylamino]methyl]-2,4,5-tris(oxidanyl)oxan-3-yl]-3-phenyl-benzamide: 46, 48, 139, 141, 142, 192, 193, 216, 217, 219, 244, 275, 278
P52789 Hexokinase-2; Hexokinase type II; HK II; Hexokinase-B; Muscle form hexokinase; EC 2.7.1.1 from Homo sapiens (Human) (see 6 papers)
33% identity, 67% coverage: 6:275/402 of query aligns to 477:755/917 of P52789
Sites not aligning to the query:
- 84:88 binding
- 142 Q → H: does not affect activity; dbSNP:rs2229621
- 148 natural variant: L -> F
- 155:156 binding
- 172:173 binding
- 208:209 binding
- 209 binding ; D→A: Decreased hexokinase activity.
- 232 binding
- 235 binding
- 260 binding
- 274 R → C: in dbSNP:rs28363006
- 291:294 binding
- 314 A → P: in dbSNP:rs28363015; natural variant: A -> V
- 331 T → I: in dbSNP:rs28363016
- 353 R → C: in dbSNP:rs61748096
- 387 A → S: in dbSNP:rs28363029
- 413:415 binding
- 449 binding
- 468 R→A: Induces a rapid dissociation of D-glucose.
- 775 R → Q: in dbSNP:rs185927605
- 801 R → Q: in dbSNP:rs28363057
- 844 R → K: in dbSNP:rs2229629
- 861:863 binding
- 881 D → N: in dbSNP:rs28363065
- 897 binding
5hexA Crystal structure of human hexokinase 2 with cmpd 30, a 2-amino-6- benzenesulfonamide glucosamine (see paper)
33% identity, 67% coverage: 6:275/402 of query aligns to 446:724/880 of 5hexA
Sites not aligning to the query:
- binding 2-[(3-bromobenzene-1-carbonyl)amino]-6-{[(4-carboxy-5-methylfuran-2-yl)sulfonyl]amino}-2,6-dideoxy-alpha-D-glucopyranos e: 136, 138, 177, 178, 198, 200, 201, 202, 204, 229, 260, 263, 383, 384, 830, 831, 832
P19367 Hexokinase-1; Brain form hexokinase; Hexokinase type I; HK I; Hexokinase-A; EC 2.7.1.1 from Homo sapiens (Human) (see 11 papers)
33% identity, 67% coverage: 6:275/402 of query aligns to 477:755/917 of P19367
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
- 30 binding
- 84:89 binding
- 84:91 binding
- 155 binding
- 172:173 binding
- 208:209 binding
- 209 binding
- 232 binding
- 235 binding
- 260 binding
- 291:294 binding
- 345 binding
- 413:415 binding
- 418 K → E: in NEDVIBA; no effect on the affinity for glucose or ATP; no effect on thermal stability; dbSNP:rs1564557037
- 425:426 binding
- 445 S → L: in NEDVIBA; no effect on the affinity for glucose or ATP; no effect on thermal stability; dbSNP:rs1064794848
- 449 binding
- 776 L → M: in dbSNP:rs1054203
- 784:788 binding
- 847 E → K: in RP79; uncertain significance; no effect on hexokinase activity; no effect on protein abundance; dbSNP:rs777849213
- 861:863 binding
- 863:867 binding
- 897 binding
4fpbA Crystal structure of recombinant human hexokinase type i with 1,5- anhydroglucitol 6-phosphate
33% identity, 67% coverage: 6:275/402 of query aligns to 462:740/899 of 4fpbA
- active site: R524 (= R64), S588 (= S124), T603 (≠ R139), D642 (= D178)
- binding 1,5-anhydro-6-O-phosphono-D-glucitol: D517 (= D57), T521 (= T61), D642 (= D178), G664 (= G201), T665 (= T202)
- binding beta-D-glucopyranose: S588 (= S124), F589 (≠ Y125), T605 (= T141), K606 (= K142), N641 (= N177), D642 (= D178), N668 (= N205), E693 (= E233), E727 (= E262)
Sites not aligning to the query:
- binding 1,5-anhydro-6-O-phosphono-D-glucitol: 69, 72, 73, 194, 214, 216, 217, 398, 400, 846, 848, 881, 882
- binding beta-D-glucopyranose: 140, 141, 157, 158, 193, 194, 219, 220, 245, 276, 279
4foeA Crystal structure of recombinant human hexokinase type i with mannose 6-phosphate
33% identity, 67% coverage: 6:275/402 of query aligns to 462:740/899 of 4foeA
- active site: R524 (= R64), S588 (= S124), T603 (≠ R139), D642 (= D178)
- binding beta-D-glucopyranose: S588 (= S124), F589 (≠ Y125), T605 (= T141), K606 (= K142), N641 (= N177), D642 (= D178), I662 (= I199), N668 (= N205), E693 (= E233), E727 (= E262)
- binding 6-O-phosphono-beta-D-mannopyranose: D517 (= D57), G520 (= G60), T521 (= T61), D642 (= D178), G664 (= G201), T665 (= T202)
Sites not aligning to the query:
- binding beta-D-glucopyranose: 140, 141, 157, 158, 193, 194, 220, 245, 276, 279
- binding 6-O-phosphono-beta-D-mannopyranose: 69, 72, 73, 194, 216, 217, 398, 399, 400, 433, 434, 846, 848, 881, 882
4f9oA Crystal structure of recombinant human hexokinase type i with 2-deoxy- glucose 6-phosphate
33% identity, 67% coverage: 6:275/402 of query aligns to 462:740/899 of 4f9oA
- active site: R524 (= R64), S588 (= S124), T603 (≠ R139), D642 (= D178)
- binding 2-deoxy-6-O-phosphono-beta-D-glucopyranose: D517 (= D57), G520 (= G60), T521 (= T61), D642 (= D178), G664 (= G201), T665 (= T202)
- binding beta-D-glucopyranose: S588 (= S124), F589 (≠ Y125), T605 (= T141), K606 (= K142), N641 (= N177), D642 (= D178), N668 (= N205), E693 (= E233), E727 (= E262)
Sites not aligning to the query:
- binding 2-deoxy-6-O-phosphono-beta-D-glucopyranose: 69, 72, 73, 194, 216, 217, 398, 399, 400, 846, 848, 882
- binding beta-D-glucopyranose: 140, 141, 157, 158, 193, 194, 218, 220, 245, 276, 279
1hkbA Crystal structure of recombinant human brain hexokinase type i complexed with glucose and glucose-6-phosphate (see paper)
33% identity, 67% coverage: 6:275/402 of query aligns to 462:740/899 of 1hkbA
- active site: R524 (= R64), S588 (= S124), T603 (≠ R139), D642 (= D178)
- binding beta-D-glucopyranose: S588 (= S124), F589 (≠ Y125), T605 (= T141), K606 (= K142), N641 (= N177), D642 (= D178), N668 (= N205), E693 (= E233), E727 (= E262)
- binding calcium ion: M675 (≠ A212), V678 (≠ I215), E679 (= E216), V681 (≠ L218), G683 (≠ N223)
- binding 6-O-phosphono-alpha-D-glucopyranose: D517 (= D57), T521 (= T61), D642 (= D178), G664 (= G201), T665 (= T202)
Sites not aligning to the query:
- binding beta-D-glucopyranose: 140, 141, 157, 158, 193, 194, 220, 245, 279
- binding calcium ion: 227, 230, 233, 235
- binding 6-O-phosphono-alpha-D-glucopyranose: 69, 73, 140, 194, 217, 398, 399, 400, 434, 846, 848, 882
1czaN Mutant monomer of recombinant human hexokinase type i complexed with glucose, glucose-6-phosphate, and adp (see paper)
33% identity, 67% coverage: 6:275/402 of query aligns to 462:740/898 of 1czaN
- active site: R524 (= R64), S588 (= S124)
- binding 6-O-phosphono-alpha-D-glucopyranose: D517 (= D57), T521 (= T61), D642 (= D178), G664 (= G201), T665 (= T202)
- binding alpha-D-glucopyranose: S588 (= S124), F589 (≠ Y125), T605 (= T141), K606 (= K142), N641 (= N177), D642 (= D178), G666 (= G203), N668 (= N205), E693 (= E233), E727 (= E262)
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 15, 358, 361, 365, 410, 411
- binding 6-O-phosphono-alpha-D-glucopyranose: 69, 72, 73, 194, 216, 217, 398, 400, 434, 846, 848, 881, 882
- binding alpha-D-glucopyranose: 140, 141, 157, 158, 193, 194, 214, 218, 220, 245, 279
4fpaA Crystal structure of recombinant human hexokinase type i mutant d413n glucose 6-phosphate
33% identity, 67% coverage: 6:275/402 of query aligns to 462:740/899 of 4fpaA
- active site: R524 (= R64), S588 (= S124), T603 (≠ R139), D642 (= D178)
- binding 6-O-phosphono-beta-D-glucopyranose: D517 (= D57), G520 (= G60), T521 (= T61), D642 (= D178), G664 (= G201), T665 (= T202)
- binding beta-D-glucopyranose: S588 (= S124), F589 (≠ Y125), T605 (= T141), K606 (= K142), N641 (= N177), D642 (= D178), I662 (= I199), N668 (= N205), E693 (= E233), E727 (= E262)
Sites not aligning to the query:
- binding 6-O-phosphono-beta-D-glucopyranose: 69, 72, 73, 194, 216, 217, 398, 399, 400, 433, 434, 846, 848, 881, 882
- binding beta-D-glucopyranose: 140, 141, 157, 158, 193, 194, 220, 245, 279
4foiA Crystal structure of recombinant human hexokinase type i mutant d413n with glucose 1,6-bisphosphate
33% identity, 67% coverage: 6:275/402 of query aligns to 462:740/899 of 4foiA
- active site: R524 (= R64), S588 (= S124), T603 (≠ R139), D642 (= D178)
- binding beta-D-glucopyranose: S588 (= S124), F589 (≠ Y125), T605 (= T141), K606 (= K142), N641 (= N177), D642 (= D178), G666 (= G203), N668 (= N205), E693 (= E233), E727 (= E262)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: D517 (= D57), T521 (= T61), N522 (= N62), R524 (= R64), D642 (= D178), G664 (= G201), T665 (= T202)
Sites not aligning to the query:
- binding beta-D-glucopyranose: 140, 141, 157, 158, 193, 194, 220, 245, 276, 279
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: 69, 73, 194, 217, 398, 399, 400, 434, 846, 848, 881, 882
3vf6A Glucokinase in complex with glucose and activator (see paper)
26% identity, 86% coverage: 6:351/402 of query aligns to 22:406/451 of 3vf6A
- active site: R84 (= R64), S144 (= S124), N159 (≠ R139), K162 (= K142), D198 (= D178)
- binding 6-({(2S)-3-cyclopentyl-2-[4-(trifluoromethyl)-1H-imidazol-1-yl]propanoyl}amino)pyridine-3-carboxylic acid: R62 (vs. gap), T64 (≠ A43), M203 (≠ L183), Y207 (≠ L187), M228 (≠ F209)
- binding alpha-D-glucopyranose: S144 (= S124), F145 (≠ Y125), T161 (= T141), K162 (= K142), N197 (= N177), D198 (= D178), N224 (= N205), E249 (= E233), E283 (= E262)
Sites not aligning to the query:
1qhaA Human hexokinase type i complexed with atp analogue amp-pnp (see paper)
32% identity, 67% coverage: 6:275/402 of query aligns to 466:744/903 of 1qhaA
- active site: R528 (= R64), S592 (= S124), T607 (≠ R139), D646 (= D178)
- binding 6-O-phosphono-alpha-D-glucopyranose: D521 (= D57), T525 (= T61), D646 (= D178), T669 (= T202)
- binding alpha-D-glucopyranose: S592 (= S124), F593 (≠ Y125), T609 (= T141), K610 (= K142), N645 (= N177), D646 (= D178), I666 (= I199), G670 (= G203), N672 (= N205), E697 (= E233), E731 (= E262)
- binding magnesium ion: M679 (≠ A212), V682 (≠ I215), V685 (≠ L218), G687 (≠ N223)
Sites not aligning to the query:
- binding phosphoaminophosphonic acid-adenylate ester: 19, 362, 369, 414, 415
- binding 6-O-phosphono-alpha-D-glucopyranose: 73, 77, 198, 221, 402, 403, 404, 438, 850, 851, 852, 885, 886
- binding alpha-D-glucopyranose: 144, 161, 162, 197, 198, 218, 222, 223, 224, 249, 283
- binding magnesium ion: 234, 237, 239
Query Sequence
>351958 FitnessBrowser__Btheta:351958
MEKNIFKLDNEQLKAIVCSFRDKTEEGLKTENAEIQCIPTFIAPKTTHIKGKSLVLDLGG
TNYRVAIVDFDKATPTVHPNNGWKKDMSIMKSVGYTREELFKELADMIIGIKREEEMPIG
YCFSYPAESVPGGDAKLLRWTKGVDIKEMVGEFIGKPLLDYLNERNKIKFTGIKVVNDTI
ASLFAGLTDNSYDAYIGLIVGTGTNMATFIPADKIEKLDQSCNAHGLIPVNLESGNFHPP
FLTAVDDTVDAISGNPGKQRFEKAVSGMYLGDILKTAFPLEEFEEKFDAQKLTSIMNYPD
IYKDVYVQVAQWIYGRSAQLVAASLTGLIMLLKSYNKDIRKVCLVAEGSLFWSENRKDKN
YNILVMEKLRELLQLFGLEDIEVDIKSMNNANLIGTGIAALS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory