Comparing 352219 FitnessBrowser__Btheta:352219 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
2g3fA Crystal structure of imidazolonepropionase complexed with imidazole-4- acetic acid sodium salt, a substrate homologue (see paper)
43% identity, 99% coverage: 3:413/417 of query aligns to 5:410/414 of 2g3fA
2bb0A Structure of imidazolonepropionase from bacillus subtilis (see paper)
43% identity, 99% coverage: 3:413/417 of query aligns to 4:409/413 of 2bb0A
P42084 Imidazolonepropionase; Imidazolone-5-propionate hydrolase; EC 3.5.2.7 from Bacillus subtilis (strain 168) (see paper)
43% identity, 99% coverage: 3:413/417 of query aligns to 6:411/421 of P42084
Q8U8Z6 Imidazolonepropionase; Imidazolone-5-propanoate hydrolase; Imidazolone-5-propionate hydrolase; EC 3.5.2.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
39% identity, 92% coverage: 32:415/417 of query aligns to 37:419/419 of Q8U8Z6
2puzB Crystal structure of imidazolonepropionase from agrobacterium tumefaciens with bound product n-formimino-l-glutamate (see paper)
39% identity, 89% coverage: 32:402/417 of query aligns to 23:391/404 of 2puzB
2gokA Crystal structure of the imidazolonepropionase from agrobacterium tumefaciens at 1.87 a resolution (see paper)
39% identity, 89% coverage: 32:402/417 of query aligns to 23:391/404 of 2gokA
A0KF84 Imidazolonepropionase; Imidazolone-5-propionate hydrolase; EC 3.5.2.7 from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) (see paper)
38% identity, 86% coverage: 53:411/417 of query aligns to 49:405/411 of A0KF84
2q09A Crystal structure of imidazolonepropionase from environmental sample with bound inhibitor 3-(2,5-dioxo-imidazolidin-4-yl)-propionic acid (see paper)
38% identity, 86% coverage: 55:411/417 of query aligns to 43:397/402 of 2q09A
2oofA The crystal structure of 4-imidazolone-5-propanoate amidohydrolase from environmental sample
38% identity, 86% coverage: 55:411/417 of query aligns to 44:398/403 of 2oofA
4f0rA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) bound zn and 5'- methylthioadenosine (unproductive complex)
27% identity, 54% coverage: 182:405/417 of query aligns to 144:389/436 of 4f0rA
Sites not aligning to the query:
4f0sA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) with bound inosine.
27% identity, 54% coverage: 182:405/417 of query aligns to 144:389/434 of 4f0sA
Sites not aligning to the query:
6oh9A Yeast guanine deaminase (see paper)
23% identity, 93% coverage: 5:390/417 of query aligns to 7:402/452 of 6oh9A
6ohaA Yeast guanine deaminase (see paper)
23% identity, 93% coverage: 5:390/417 of query aligns to 7:402/451 of 6ohaA
4dzhA Crystal structure of an adenosine deaminase from xanthomonas campestris (target nysgrc-200456) with bound zn
31% identity, 35% coverage: 253:398/417 of query aligns to 228:386/439 of 4dzhA
Sites not aligning to the query:
4whbA Crystal structure of phenylurea hydrolase b (see paper)
34% identity, 20% coverage: 306:390/417 of query aligns to 322:423/459 of 4whbA
Sites not aligning to the query:
>352219 FitnessBrowser__Btheta:352219
MSENLIIFNARIVTPTGTSARKGAEMGQLRIIENGTVEVTKGIITYVGESRGEDRDGYYQ
HYWHYNARGHCLLPGFVDSHTHFVFGGERSEEFSWRLKGESYMSIMERGGGIASTVKATR
QMNFLKLRSAAEGFLKKMSAMGVTTVEGKSGYGLDRETELLQLKIMRSLNNDEHKRIDIV
STFLGAHALPEEYKGRGDEYIDFLIREMLPVIRENELAECCDVFCEQGVFSVEQSRRLLQ
AAKEQGFLLKLHADEIVSFGGAELAAELGALSADHLLQASDAGIRAMADAGVVATLLPLT
AFALKEPYARGREMIDAGCAVALATDLNPGSCFSGSIPLTIALACIYMKLSIEETITALT
LNGAAALHRADRIGSIEVGKQGDFVILNSDNYHILPYYVGMNCVIMTIKGGMLYPVN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory