SitesBLAST
Comparing 352326 FitnessBrowser__Btheta:352326 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4lbxA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with cytidine
38% identity, 93% coverage: 4:308/329 of query aligns to 7:314/331 of 4lbxA
- active site: R126 (= R125), G276 (= G270), A277 (= A271), G278 (= G272), D279 (= D273)
- binding adenosine: N12 (= N9), I14 (≠ L11), D16 (= D13), M36 (= M34), G59 (= G59), G60 (= G60), S61 (= S61), N64 (= N64), M128 (≠ F127), T130 (= T129), E157 (= E156), Y159 (= Y158), T275 (= T269), D279 (= D273)
- binding 4-amino-1-beta-d-ribofuranosyl-2(1h)-pyrimidinone: T246 (≠ K240), S248 (≠ G242), G251 (= G245), C303 (≠ S297), A306 (≠ S300), I310 (= I304)
Sites not aligning to the query:
4k8kA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with 1-(4-methoxyphenyl)-1-cyclopropane and 2- aminoperimidine
38% identity, 93% coverage: 4:308/329 of query aligns to 7:314/331 of 4k8kA
- active site: R126 (= R125), G276 (= G270), A277 (= A271), G278 (= G272), D279 (= D273)
- binding 1-(4-methoxyphenyl)cyclopropanecarboxylic acid: A41 (≠ D39), A44 (≠ L42), E45 (≠ Q43), Y48 (≠ F49), P112 (≠ S112), R115 (≠ A115), M117 (≠ T117), Y131 (= Y130)
- binding 1H-perimidin-2-amine: A84 (≠ N84), D85 (= D85), D89 (= D89)
- binding adenosine: N12 (= N9), I14 (≠ L11), D16 (= D13), M36 (= M34), G59 (= G59), G60 (= G60), S61 (= S61), N64 (= N64), M128 (≠ F127), T130 (= T129), E157 (= E156), Y159 (= Y158), T275 (= T269), D279 (= D273)
Sites not aligning to the query:
4k8pA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with 2-ethylbenzyl alcohol
38% identity, 93% coverage: 4:308/329 of query aligns to 8:315/332 of 4k8pA
- active site: R127 (= R125), G277 (= G270), A278 (= A271), G279 (= G272), D280 (= D273)
- binding (2-ethylphenyl)methanol: A45 (≠ L42), Y49 (≠ F49), R116 (≠ A115)
- binding adenosine: N13 (= N9), I15 (≠ L11), D17 (= D13), M37 (= M34), G60 (= G59), G61 (= G60), S62 (= S61), N65 (= N64), M129 (≠ F127), T131 (= T129), E158 (= E156), Y160 (= Y158), T276 (= T269), D280 (= D273)
Sites not aligning to the query:
4lc4A Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with guanosine
38% identity, 93% coverage: 4:308/329 of query aligns to 6:313/330 of 4lc4A
- active site: R125 (= R125), G275 (= G270), A276 (= A271), G277 (= G272), D278 (= D273)
- binding adenosine: N11 (= N9), I13 (≠ L11), D15 (= D13), M35 (= M34), G58 (= G59), G59 (= G60), S60 (= S61), N63 (= N64), M127 (≠ F127), T129 (= T129), E156 (= E156), Y158 (= Y158), T274 (= T269), D278 (= D273)
- binding guanosine: T245 (≠ K240), S247 (≠ G242), E248 (≠ A243), A305 (≠ S300), I309 (= I304)
Sites not aligning to the query:
4kbeA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with benzoguanamine
38% identity, 93% coverage: 4:308/329 of query aligns to 6:313/330 of 4kbeA
- active site: R125 (= R125), G275 (= G270), A276 (= A271), G277 (= G272), D278 (= D273)
- binding adenosine: N11 (= N9), I13 (≠ L11), D15 (= D13), M35 (= M34), G58 (= G59), G59 (= G60), S60 (= S61), N63 (= N64), M127 (≠ F127), T129 (= T129), E156 (= E156), Y158 (= Y158), D278 (= D273)
- binding 6-phenyl-1,3,5-triazine-2,4-diamine: I17 (≠ L15), S18 (≠ A16), R19 (≠ T17), P52 (≠ T54), A53 (≠ H55), L54 (= L56)
Sites not aligning to the query:
4kanA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with 2-(2,5-dimethyl-1,3-thiazol-4-yl)acetic acid
38% identity, 93% coverage: 4:308/329 of query aligns to 6:313/330 of 4kanA
- active site: R125 (= R125), G275 (= G270), A276 (= A271), G277 (= G272), D278 (= D273)
- binding adenosine: N11 (= N9), I13 (≠ L11), D15 (= D13), M35 (= M34), G58 (= G59), G59 (= G60), S60 (= S61), N63 (= N64), M127 (≠ F127), T129 (= T129), E156 (= E156), Y158 (= Y158), T274 (= T269), D278 (= D273)
- binding (2,5-dimethyl-1,3-thiazol-4-yl)acetic acid: I16 (≠ V14), A43 (≠ L42), E44 (≠ Q43), Y47 (≠ F49), R114 (≠ A115), M116 (≠ T117), N215 (= N211), T245 (≠ K240), S247 (≠ G242), A276 (= A271)
Sites not aligning to the query:
4kalA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with quinoline-3-carboxylic acid
38% identity, 93% coverage: 4:308/329 of query aligns to 6:313/330 of 4kalA
- active site: R125 (= R125), G275 (= G270), A276 (= A271), G277 (= G272), D278 (= D273)
- binding adenosine: N11 (= N9), I13 (≠ L11), D15 (= D13), M35 (= M34), G58 (= G59), G59 (= G60), N63 (= N64), M127 (≠ F127), T129 (= T129), E156 (= E156), Y158 (= Y158), T274 (= T269), D278 (= D273)
- binding quinoline-3-carboxylic acid: S190 (= S186), F191 (≠ Y187), D194 (≠ V190), S221 (≠ A217), Q224 (≠ T219)
4kahA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with 4-bromo-1h-pyrazole
38% identity, 93% coverage: 4:308/329 of query aligns to 6:313/330 of 4kahA
- active site: R125 (= R125), G275 (= G270), A276 (= A271), G277 (= G272), D278 (= D273)
- binding adenosine: N11 (= N9), I13 (≠ L11), D15 (= D13), M35 (= M34), G58 (= G59), G59 (= G60), S60 (= S61), N63 (= N64), M127 (≠ F127), T129 (= T129), E156 (= E156), Y158 (= Y158), T274 (= T269), D278 (= D273)
- binding 4-bromo-1H-pyrazole: I16 (≠ V14), Y47 (≠ F49), L86 (≠ Y87)
Sites not aligning to the query:
4kadA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with n1-(2.3-dihydro-1h-inden-5-yl)acetam
38% identity, 93% coverage: 4:308/329 of query aligns to 6:313/330 of 4kadA
- active site: R125 (= R125), G275 (= G270), A276 (= A271), G277 (= G272), D278 (= D273)
- binding N-(4,7-dihydro-1H-inden-6-yl)acetamide: S247 (≠ G242), E248 (≠ A243), A305 (≠ S300), I309 (= I304)
- binding adenosine: N11 (= N9), I13 (≠ L11), D15 (= D13), M35 (= M34), G58 (= G59), G59 (= G60), S60 (= S61), N63 (= N64), M127 (≠ F127), T129 (= T129), E156 (= E156), Y158 (= Y158), T274 (= T269), D278 (= D273)
4k9iA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with norharmane
38% identity, 93% coverage: 4:308/329 of query aligns to 6:313/330 of 4k9iA
- active site: R125 (= R125), G275 (= G270), A276 (= A271), G277 (= G272), D278 (= D273)
- binding adenosine: N11 (= N9), I13 (≠ L11), D15 (= D13), M35 (= M34), G58 (= G59), G59 (= G60), S60 (= S61), N63 (= N64), M127 (≠ F127), T129 (= T129), E156 (= E156), Y158 (= Y158), T274 (= T269), D278 (= D273)
- binding Norharmane: S190 (= S186), F191 (≠ Y187), D194 (≠ V190), Q224 (≠ T219)
4k9cA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with n-(hydroxymethyl)benzamide and 4-methyl-3,4- dihydro-2h-1,4-benzoxazine-7-carboxylic acid
38% identity, 93% coverage: 4:308/329 of query aligns to 6:313/330 of 4k9cA
- active site: R125 (= R125), G275 (= G270), A276 (= A271), G277 (= G272), D278 (= D273)
- binding N-(hydroxymethyl)benzamide: Y47 (≠ F49), Q85 (≠ H86), L86 (≠ Y87), D88 (= D89), P111 (≠ S112), R114 (≠ A115)
- binding adenosine: N11 (= N9), I13 (≠ L11), D15 (= D13), M35 (= M34), G58 (= G59), G59 (= G60), S60 (= S61), N63 (= N64), M127 (≠ F127), T129 (= T129), E156 (= E156), Y158 (= Y158), T274 (= T269), D278 (= D273)
- binding 4-methyl-3,4-dihydro-2H-1,4-benzoxazine-7-carboxylic acid: S190 (= S186), F191 (≠ Y187), D194 (≠ V190), Q224 (≠ T219)
Sites not aligning to the query:
4k93A Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with n-(hydroxymethyl)benzamide
38% identity, 93% coverage: 4:308/329 of query aligns to 6:313/330 of 4k93A
- active site: R125 (= R125), G275 (= G270), A276 (= A271), G277 (= G272), D278 (= D273)
- binding N-(hydroxymethyl)benzamide: L37 (= L36), I38 (= I37), Y47 (≠ F49), Q85 (≠ H86), D88 (= D89), R114 (≠ A115), L131 (= L131), D161 (vs. gap), S190 (= S186), F191 (≠ Y187), D194 (≠ V190), R197 (≠ D193), L220 (≠ K216), S221 (≠ A217), Q224 (≠ T219), D226 (≠ E221), R234 (≠ V229)
- binding adenosine: N11 (= N9), I13 (≠ L11), D15 (= D13), M35 (= M34), G58 (= G59), G59 (= G60), S60 (= S61), N63 (= N64), M127 (≠ F127), T129 (= T129), E156 (= E156), Y158 (= Y158), T274 (= T269), D278 (= D273)
Sites not aligning to the query:
4k8tA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with ethyl 3,4-diaminobenzoate
38% identity, 93% coverage: 4:308/329 of query aligns to 6:313/330 of 4k8tA
- active site: R125 (= R125), G275 (= G270), A276 (= A271), G277 (= G272), D278 (= D273)
- binding adenosine: N11 (= N9), I13 (≠ L11), D15 (= D13), M35 (= M34), G58 (= G59), G59 (= G60), S60 (= S61), N63 (= N64), M127 (≠ F127), T129 (= T129), E156 (= E156), Y158 (= Y158), T274 (= T269), D278 (= D273)
- binding ethyl 3,4-diaminobenzoate: F109 (≠ L110), P111 (≠ S112), R114 (≠ A115), Y130 (= Y130)
Sites not aligning to the query:
4k8cA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with adp
38% identity, 93% coverage: 4:308/329 of query aligns to 6:313/330 of 4k8cA
- active site: R125 (= R125), G275 (= G270), A276 (= A271), G277 (= G272), D278 (= D273)
- binding adenosine: N11 (= N9), I13 (≠ L11), D15 (= D13), M35 (= M34), G58 (= G59), G59 (= G60), N63 (= N64), M127 (≠ F127), T129 (= T129), E156 (= E156), Y158 (= Y158), T274 (= T269), D278 (= D273)
- binding adenosine-5'-diphosphate: N215 (= N211), T245 (≠ K240), S247 (≠ G242), E248 (≠ A243), G250 (= G245), A264 (= A259), A276 (= A271), G277 (= G272), C302 (≠ S297), A305 (≠ S300), I309 (= I304)
4jkuA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with quinaldic acid, nysgrc target 14306
38% identity, 93% coverage: 4:308/329 of query aligns to 6:313/330 of 4jkuA
- active site: R125 (= R125), G275 (= G270), A276 (= A271), G277 (= G272), D278 (= D273)
- binding adenosine: N11 (= N9), I13 (≠ L11), D15 (= D13), M35 (= M34), G58 (= G59), G59 (= G60), S60 (= S61), N63 (= N64), M127 (≠ F127), T129 (= T129), E156 (= E156), Y158 (= Y158), T274 (= T269), D278 (= D273)
- binding quinoline-2-carboxylic acid: S190 (= S186), F191 (≠ Y187), D194 (≠ V190), S221 (≠ A217), Q224 (≠ T219)
3uboA The crystal structure of adenosine kinase from sinorhizobium meliloti
35% identity, 93% coverage: 4:308/329 of query aligns to 5:312/338 of 3uboA
- active site: R124 (= R125), G274 (= G270), A275 (= A271), G276 (= G272), D277 (= D273)
- binding adenosine: N10 (= N9), I12 (≠ L11), D14 (= D13), M34 (= M34), G57 (= G59), G58 (= G60), S59 (= S61), N62 (= N64), M126 (≠ F127), T128 (= T129), E155 (= E156), Y157 (= Y158), G274 (= G270), D277 (= D273)
- binding adenosine-5'-diphosphate: N214 (= N211), T244 (≠ K240), S246 (≠ G242), E247 (≠ A243), G249 (= G245), L266 (≠ V262), A275 (= A271), G276 (= G272), N301 (≠ S297), A304 (≠ S300), I308 (= I304)
Sites not aligning to the query:
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
28% identity, 78% coverage: 53:310/329 of query aligns to 33:295/312 of 3in1A
- active site: R106 (= R125), G255 (= G270), A256 (= A271), G257 (= G272), D258 (= D273)
- binding adenosine-5'-diphosphate: N194 (= N211), K225 (= K240), G227 (= G242), G230 (= G245), A244 (= A259), T253 (= T268), N282 (≠ S297), A285 (≠ S300)
8cqxA Ribokinase from t.Sp mutant a92g
28% identity, 86% coverage: 11:294/329 of query aligns to 1:269/300 of 8cqxA
Sites not aligning to the query:
5kb5A Crystal structure of the adenosine kinase from mus musculus in complex with adenosine and adenosine-diphosphate
27% identity, 95% coverage: 4:317/329 of query aligns to 6:340/341 of 5kb5A
- active site: R129 (= R125), G294 (= G270), A295 (= A271), G296 (= G272), D297 (= D273)
- binding adenosine: N11 (= N9), L13 (= L11), D15 (= D13), G61 (= G60), S62 (= S61), N65 (= N64), C120 (≠ A115), L131 (≠ F127), A133 (≠ T129), F167 (≠ G157), N293 (≠ T269), D297 (= D273)
- binding adenosine-5'-diphosphate: R129 (= R125), N220 (= N211), T262 (= T252), G264 (vs. gap), R265 (vs. gap), V281 (= V262), Q286 (vs. gap), I289 (≠ V265), A295 (= A271), G296 (= G272), A324 (≠ S300), I328 (= I304)
P55264 Adenosine kinase; AK; Adenosine 5'-phosphotransferase; EC 2.7.1.20 from Mus musculus (Mouse) (see paper)
27% identity, 95% coverage: 4:317/329 of query aligns to 25:359/361 of P55264
- S48 (≠ E28) mutation to A: No effect on in vitro phosphorylation by PKC.
- S85 (≠ A65) mutation to A: No effect on in vitro phosphorylation by PKC.
- S272 (≠ A243) mutation to A: No effect on in vitro phosphorylation by PKC.
- S328 (≠ C285) mutation to A: No effect on in vitro phosphorylation by PKC.
Query Sequence
>352326 FitnessBrowser__Btheta:352326
MDKIIGLGNALIDVLATLKDDTLLDELELPKGSMQLIDDAKLQQINTKFSQMKTHLATGG
SAGNAILGLACLGAGTGFIGKVGNDHYGDFFRKNLQKNNIEDNLLTSEQLPSGVASTFIS
QDGERTFGTYLGAAASLKAEDLTLEMFKGYAYLFIEGYLVQDHEMILHAIELAKEAGLQI
CLDMASYNIVENDLEFFSLLINKYVDIVFANEEEAKAFTGEEPEEALRVIAKKCSIAIVK
VGANGSYIRKGTEEIKVSAIPVEKVLDTTGAGDYFAAGFLYGLTCGYSLEKCAKIGSILS
GNVIQVIGTTISPERWDEIKLNINKVLAE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory