Comparing 353245 FitnessBrowser__Btheta:353245 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
31% identity, 97% coverage: 8:356/360 of query aligns to 5:352/365 of 2j5tD
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
31% identity, 97% coverage: 8:356/360 of query aligns to 7:354/367 of P0A7B5
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
29% identity, 97% coverage: 8:356/360 of query aligns to 5:312/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
28% identity, 97% coverage: 8:356/360 of query aligns to 5:310/323 of 2j5vA
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
34% identity, 64% coverage: 7:235/360 of query aligns to 2:219/241 of 2akoA
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
33% identity, 64% coverage: 7:238/360 of query aligns to 14:240/258 of 7wx3B
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
31% identity, 64% coverage: 7:238/360 of query aligns to 14:218/236 of 7f5xA
3wwmA Crystal structure of lysz from thermus thermophilus with adp (see paper)
25% identity, 35% coverage: 65:191/360 of query aligns to 84:210/269 of 3wwmA
Sites not aligning to the query:
O50147 [LysW]-aminoadipate kinase; EC 2.7.2.17 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
25% identity, 35% coverage: 65:191/360 of query aligns to 84:210/269 of O50147
Sites not aligning to the query:
>353245 FitnessBrowser__Btheta:353245
MKQEFTRIAVKVGSNVLARRDGTLDVTRMSALVDQIAELNKSGVEIILISSGAVASGRSE
IHPQKKLDSVDQRQLFSAVGQAKLINRYYELFREHGIAVGQVLTTKENFSTRRHYLNQKN
CMTVMLENGVIPIVNENDTISVSELMFTDNDELSGLIASMMDAQALIILSNIDGIYNGSP
SDPASAVIREIEHGKDLSNYIQATKSSFGRGGMLTKTNIARKVADEGITVIIANGKRDNI
LVDLLQQPDDTVCTRFIPSTEAVSSVKKWIAHSEGFAKGEIHINECATDILSSEKAASIL
PVGITHIEGEFEKDDIVRIMDFLGNQVGVGKANCDSAQAREAMGKHGKKPVVHYDYLYIE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory