Comparing 353292 FitnessBrowser__Btheta:353292 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
1gt7A L-rhamnulose-1-phosphate aldolase from escherichia coli (see paper)
32% identity, 90% coverage: 26:267/269 of query aligns to 21:265/274 of 1gt7A
P32169 Rhamnulose-1-phosphate aldolase; EC 4.1.2.19 from Escherichia coli (strain K12) (see 2 papers)
32% identity, 90% coverage: 26:267/269 of query aligns to 21:265/274 of P32169
2v9mA L-rhamnulose-1-phosphate aldolase from escherichia coli (mutant a87m- t109f-e192a) (see paper)
32% identity, 90% coverage: 26:267/269 of query aligns to 21:265/274 of 2v9mA
1ojrA L-rhamnulose-1-phosphate aldolase from escherichia coli (mutant e192a) (see paper)
31% identity, 90% coverage: 26:267/269 of query aligns to 21:265/274 of 1ojrA
Q58813 L-fuculose phosphate aldolase; L-fuculose-1-phosphate aldolase; EC 4.1.2.17 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
29% identity, 45% coverage: 116:237/269 of query aligns to 65:170/181 of Q58813
Sites not aligning to the query:
>353292 FitnessBrowser__Btheta:353292
MKSILENRPALAKEVNKVAEVAGYLWQKGWAERNGGNITVNITEFVDDEIRRMEPISEVK
SIGVTLPYLKGCYFYCKGTNKRMRDLARWPMENGSVIRILDDCASYVIIADEAVAPTSEL
PSHLSVHNDLLSKNSPYKASVHTHPIELIAMTHCEKFLQKDVATNLLWSMIPETKAFCPR
GLGIIPYKLPSSVELAEATIKELQDYDVVMWEKHGVFAVDCDAMQAFDQIDVLNKSALIY
IAAKNMGFEPDGMSQEQMKEMSVAFNLPK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory