SitesBLAST
Comparing 353437 FitnessBrowser__Btheta:353437 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P80039 Malate dehydrogenase; EC 1.1.1.37 from Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum) (see paper)
49% identity, 95% coverage: 3:300/313 of query aligns to 2:298/310 of P80039
1guzA Structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases (see paper)
48% identity, 95% coverage: 3:300/313 of query aligns to 2:298/305 of 1guzA
- active site: D147 (= D149), R150 (= R152), H174 (= H176)
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), N10 (= N11), V11 (= V12), D32 (= D33), V33 (= V34), T76 (= T78), G78 (= G80), L79 (≠ I81), P80 (= P82), I97 (= I99), V117 (≠ I119), N119 (= N121), M142 (= M144), L146 (= L148), H174 (= H176), P228 (= P230)
7byaA Malate dehydrogenase from geobacillus stearothermophilus (gs-mdh) complexed with oxaloacetic acid (oaa) and adenosine 5'- diphosphoribose (apr) (see paper)
47% identity, 96% coverage: 2:301/313 of query aligns to 5:304/311 of 7byaA
7by9A Malate dehydrogenase from geobacillus stearothermophilus (gs-mdh) complexed with oxaloacetic acid (oaa) and nicotinamide adenine dinucleotide (NAD) (see paper)
47% identity, 96% coverage: 2:301/313 of query aligns to 5:304/311 of 7by9A
- binding nicotinamide-adenine-dinucleotide: G11 (= G8), G13 (= G10), F14 (≠ N11), T15 (≠ V12), D35 (= D33), I36 (≠ V34), T81 (= T78), A82 (≠ S79), I102 (= I99), Q105 (≠ S102), V106 (= V103), L122 (≠ I119), N124 (= N121), V126 (≠ M123)
- binding oxaloacetate ion: L151 (= L148), R155 (= R152), H179 (= H176), G217 (= G215)
7f8dA Malate dehydrogenase from geobacillus stearothermophilus (gs-mdh) g218y mutant (see paper)
47% identity, 96% coverage: 2:301/313 of query aligns to 7:306/313 of 7f8dA
- binding nicotinamide-adenine-dinucleotide: G15 (= G10), F16 (≠ N11), T17 (≠ V12), D37 (= D33), I38 (≠ V34), L41 (vs. gap), Y71 (= Y66), T83 (= T78), A84 (≠ S79), G85 (= G80), L124 (≠ I119), T125 (≠ S120), N126 (= N121), Q149 (≠ M144), L153 (= L148), P235 (= P230)
4pltB Crystal structure of ancestral apicomplexan malate dehydrogenase with oxamate. (see paper)
47% identity, 96% coverage: 3:301/313 of query aligns to 5:311/319 of 4pltB
- active site: R94 (= R89), D154 (= D149), R157 (= R152), H181 (= H176)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G12 (= G10), N13 (= N11), I14 (≠ V12), F33 (≠ L32), D34 (= D33), I35 (≠ V34), T78 (= T78), A79 (≠ S79), G80 (= G80), I81 (= I81), P82 (= P82), I104 (= I99), V124 (≠ I119), N126 (= N121), M149 (= M144), H181 (= H176), P240 (= P230)
4plyA Crystal structure of ancestral apicomplexan malate dehydrogenase with malate. (see paper)
47% identity, 96% coverage: 3:301/313 of query aligns to 4:310/318 of 4plyA
- active site: D153 (= D149), R156 (= R152), H180 (= H176)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G10), N12 (= N11), I13 (≠ V12), D33 (= D33), I34 (≠ V34), Y65 (= Y66), T77 (= T78), A78 (≠ S79), G79 (= G80), I80 (= I81), P81 (= P82), I103 (= I99), V123 (≠ I119), N125 (= N121), M148 (= M144), L152 (= L148), H180 (= H176), P239 (= P230)
- binding pyruvic acid: W91 (≠ M87), R93 (= R89), N125 (= N121), R156 (= R152), H180 (= H176), G223 (= G215)
1uxgA Large improvement in the thermal stability of a tetrameric malate dehydrogenase by single point mutations at the dimer-dimer interface. (see paper)
49% identity, 98% coverage: 3:310/313 of query aligns to 3:308/308 of 1uxgA
- active site: R87 (= R89), D147 (= D149), R150 (= R152), H174 (= H176)
- binding fumaric acid: R81 (= R83), R87 (= R89), L146 (= L148), R150 (= R152), H174 (= H176), G212 (= G215), S223 (= S225)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (≠ N11), V12 (= V12), D32 (= D33), T76 (= T78), S77 (= S79), G78 (= G80), A79 (≠ I81), P80 (= P82), C101 (≠ V103), V117 (≠ I119), N119 (= N121), Q142 (≠ M144), H174 (= H176), P228 (= P230)
P80040 Malate dehydrogenase; EC 1.1.1.37 from Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) (see 2 papers)
49% identity, 98% coverage: 3:310/313 of query aligns to 4:309/309 of P80040
1gv0A Structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases (see paper)
48% identity, 95% coverage: 3:300/313 of query aligns to 2:294/301 of 1gv0A
- active site: D143 (= D149), R146 (= R152), H170 (= H176)
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), N10 (= N11), V11 (= V12), D32 (= D33), V33 (= V34), T76 (= T78), A77 (≠ S79), G78 (= G80), L79 (≠ I81), P80 (= P82), V113 (≠ I119), N115 (= N121), M138 (= M144), P224 (= P230)
P49814 Malate dehydrogenase; Vegetative protein 69; VEG69; EC 1.1.1.37 from Bacillus subtilis (strain 168) (see 2 papers)
45% identity, 96% coverage: 3:301/313 of query aligns to 7:305/312 of P49814
- S149 (≠ G145) modified: Phosphoserine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
5ujkA Malate dehydrogenase from methylobacterium extorquens, complexed with NAD (see paper)
42% identity, 99% coverage: 2:310/313 of query aligns to 3:314/315 of 5ujkA
- active site: R88 (= R89), D148 (= D149), R151 (= R152), H175 (= H176)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), Q12 (≠ N11), I13 (≠ V12), D33 (= D33), I34 (≠ V34), T77 (= T78), A78 (≠ S79), G79 (= G80), V98 (≠ I99), I118 (= I119), N120 (= N121), M143 (= M144), L147 (= L148), H175 (= H176)
4rosA Crystal structure of methylobacterium extorquens malate dehydrogenase complexed with oxaloacetate and adenosine-5-diphosphoribose
42% identity, 99% coverage: 2:310/313 of query aligns to 3:314/318 of 4rosA
- active site: R88 (= R89), D148 (= D149), R151 (= R152), H175 (= H176)
- binding adenosine-5-diphosphoribose: G11 (= G10), Q12 (≠ N11), I13 (≠ V12), D33 (= D33), I34 (≠ V34), T77 (= T78), A78 (≠ S79), G79 (= G80), V80 (≠ I81), P81 (= P82), V98 (≠ I99), T119 (≠ S120), N120 (= N121)
- binding oxaloacetate ion: R82 (= R83), R88 (= R89), N120 (= N121), L147 (= L148), R151 (= R152), H175 (= H176), G218 (= G215)
3gvhA Crystal structure of lactate/malate dehydrogenase from brucella melitensis
41% identity, 96% coverage: 2:302/313 of query aligns to 3:306/318 of 3gvhA
- active site: R88 (= R89), D148 (= D149), R151 (= R152), H175 (= H176)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), I13 (≠ V12), D33 (= D33), I34 (≠ V34), T77 (= T78), A78 (≠ S79), I118 (= I119), N120 (= N121), M143 (= M144), L147 (= L148), H175 (= H176)
4plfB Crystal structure of ancestral apicomplexan lactate dehydrogenase with lactate. (see paper)
40% identity, 99% coverage: 2:311/313 of query aligns to 5:322/330 of 4plfB
- active site: R95 (= R89), D155 (= D149), R158 (= R152), H182 (= H176)
- binding nicotinamide-adenine-dinucleotide: G13 (= G10), M14 (≠ N11), I15 (≠ V12), F34 (≠ L32), D35 (= D33), V36 (= V34), T79 (= T78), A80 (≠ S79), G81 (= G80), L82 (≠ I81), T83 (≠ P82), I105 (= I99), I125 (= I119), N127 (= N121), M150 (= M144), H182 (= H176), P241 (= P230)
- binding pyruvic acid: W93 (≠ M87), R95 (= R89), N127 (= N121), R158 (= R152), H182 (= H176)
4plcA Crystal structure of ancestral apicomplexan lactate dehydrogenase with malate. (see paper)
40% identity, 99% coverage: 2:311/313 of query aligns to 5:322/324 of 4plcA
- active site: R95 (= R89), D155 (= D149), R158 (= R152), H182 (= H176)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G13 (= G10), M14 (≠ N11), I15 (≠ V12), D35 (= D33), V36 (= V34), T79 (= T78), A80 (≠ S79), G81 (= G80), L82 (≠ I81), T83 (≠ P82), I125 (= I119), N127 (= N121), M150 (= M144), H182 (= H176), P241 (= P230)
- binding pyruvic acid: W93 (≠ M87), R95 (= R89), N127 (= N121), R158 (= R152), H182 (= H176), G225 (= G215)
3gviA Crystal structure of lactate/malate dehydrogenase from brucella melitensis in complex with adp
40% identity, 96% coverage: 2:302/313 of query aligns to 3:301/314 of 3gviA
2hjrB Crystal structure of cryptosporidium parvum malate dehydrogenase (see paper)
43% identity, 98% coverage: 3:310/313 of query aligns to 4:314/314 of 2hjrB
- active site: R88 (= R89), D148 (= D149), R151 (= R152), H175 (= H176)
- binding adenosine-5-diphosphoribose: G11 (= G10), Q12 (≠ N11), I13 (≠ V12), D33 (= D33), I34 (≠ V34), I35 (≠ K35), Y65 (= Y66), T77 (= T78), A78 (≠ S79), G79 (= G80), V80 (≠ I81), P81 (= P82), T119 (≠ S120), N120 (= N121)
6vdjA Crystal structure of ancestral apicomplexan lactate dehydrogenase with sulfate and nadh4.
41% identity, 98% coverage: 3:308/313 of query aligns to 4:305/308 of 6vdjA
- binding 1,4,5,6-tetrahydronicotinamide adenine dinucleotide: G11 (= G10), M12 (≠ N11), I13 (≠ V12), D33 (= D33), V34 (= V34), A78 (≠ S79), I91 (= I99), I111 (= I119), T112 (≠ S120), N113 (= N121), M136 (= M144), H168 (= H176)
1sowA T. Gondii bradyzoite-specific ldh (ldh2) in complex with NAD and oxalate
39% identity, 97% coverage: 3:307/313 of query aligns to 7:319/322 of 1sowA
- active site: R96 (= R89), D156 (= D149), R159 (= R152), H183 (= H176)
- binding nicotinamide-adenine-dinucleotide: G14 (= G10), M15 (≠ N11), I16 (≠ V12), D36 (= D33), V37 (= V34), T80 (= T78), A81 (≠ S79), G82 (= G80), L83 (≠ I81), T84 (≠ P82), I106 (= I99), E109 (≠ S102), V126 (≠ I119), T127 (≠ S120), N128 (= N121), M151 (= M144), L155 (= L148), H183 (= H176), P242 (= P230)
- binding oxalate ion: W94 (≠ M87), R96 (= R89), R159 (= R152), H183 (= H176), G226 (= G215)
Query Sequence
>353437 FitnessBrowser__Btheta:353437
MSKVTVVGAGNVGATCANVLAFNEVADEVVMLDVKEGVSEGKAMDMMQTAQLLGFDTTVV
GCTNDYAQTANSDVVVITSGIPRKPGMTREELIGVNAGIVKSVAENILKYSPNAILVVIS
NPMDTMTYLSLKALGLPKNRIIGMGGALDSSRFKYFLSQALGCNANEVEGMVIGGHGDTT
MIPLTRFATYKGMPVTNFISEEKLNEVAAATMVGGATLTKLLGTSAWYAPGAAGAFVVES
ILHDQKKMIPCSVYLEGEYGESDICIGVPVILGKNGIEKIVELDLNADEKAKFAASAKAV
HGTNAALKEVGAL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory