SitesBLAST
Comparing 354080 FitnessBrowser__Btheta:354080 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3bjeA Crystal structure of trypanosoma brucei nucleoside phosphorylase shows uridine phosphorylase activity (see paper)
30% identity, 89% coverage: 9:269/292 of query aligns to 1:298/327 of 3bjeA
- binding calcium ion: M73 (≠ I79), D76 (= D82), N77 (= N83)
- binding 1-O-phosphono-alpha-D-ribofuranose: H12 (= H20), G28 (= G36), R32 (= R40), R52 (= R58), M73 (≠ I79), R123 (= R115), T126 (= T118), M271 (= M242), E272 (= E243)
- binding uracil: C127 (= C119), G128 (= G120), F228 (= F206), Q232 (= Q210), R234 (= R212)
3qpbC Crystal structure of streptococcus pyogenes uridine phosphorylase reveals a subclass of the np-i superfamily (see paper)
29% identity, 87% coverage: 14:268/292 of query aligns to 4:220/254 of 3qpbC
- active site: H10 (= H20), G26 (= G36), R30 (= R40), R48 (= R58), E80 (= E90), R91 (= R115), T94 (= T118), V217 (≠ I265), G218 (≠ A266), Q220 (≠ R268)
- binding 1-O-phosphono-alpha-D-ribofuranose: H10 (= H20), G26 (= G36), R30 (= R40), R48 (= R58), R91 (= R115), T94 (= T118), F162 (= F206), E193 (= E241), M194 (= M242), E195 (= E243)
- binding uracil: T94 (= T118), C95 (= C119), G96 (= G120), K159 (≠ A203), F162 (= F206), Q165 (≠ P209), H166 (≠ Q210)
Sites not aligning to the query:
4daeA Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with 6-chloroguanosine (see paper)
27% identity, 92% coverage: 20:288/292 of query aligns to 4:231/232 of 4daeA
- active site: H4 (= H20), G20 (= G36), R24 (= R40), R43 (= R58), E75 (= E90), R87 (= R115), S90 (≠ T118), S202 (≠ I265), D203 (≠ A266), V205 (≠ R268), R216 (≠ A273)
- binding 6-chloro-9-(beta-D-ribofuranosyl)-9H-purin-2-amine: M64 (≠ I79), S90 (≠ T118), C91 (= C119), G92 (= G120), F159 (≠ K222), E178 (= E241), M179 (= M242), E180 (= E243), S202 (≠ I265)
4da0A Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with 2'-deoxyguanosine (see paper)
27% identity, 92% coverage: 20:288/292 of query aligns to 3:230/230 of 4da0A
- active site: H3 (= H20), G19 (= G36), R23 (= R40), R42 (= R58), E74 (= E90), R86 (= R115), S89 (≠ T118), S201 (≠ I265), D202 (≠ A266), V204 (≠ R268), R215 (≠ A273)
- binding 2'-deoxy-guanosine: S89 (≠ T118), C90 (= C119), G91 (= G120), F158 (≠ K222), V176 (≠ F240), E177 (= E241), M178 (= M242), E179 (= E243), S201 (≠ I265)
4darA Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with tubercidin (see paper)
27% identity, 92% coverage: 20:288/292 of query aligns to 3:230/231 of 4darA
- active site: H3 (= H20), G19 (= G36), R23 (= R40), R42 (= R58), E74 (= E90), R86 (= R115), S89 (≠ T118), S201 (≠ I265), D202 (≠ A266), V204 (≠ R268), R215 (≠ A273)
- binding '2-(4-amino-pyrrolo[2,3-d]pyrimidin-7-yl)-5-hydroxymethyl-tetrahydro-furan-3,4-diol: S89 (≠ T118), C90 (= C119), G91 (= G120), F158 (≠ K222), E177 (= E241), M178 (= M242), E179 (= E243), S201 (≠ I265)
4dabA Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with hypoxanthine (see paper)
27% identity, 92% coverage: 20:288/292 of query aligns to 3:230/231 of 4dabA
- active site: H3 (= H20), G19 (= G36), R23 (= R40), R42 (= R58), E74 (= E90), R86 (= R115), S89 (≠ T118), S201 (≠ I265), D202 (≠ A266), V204 (≠ R268), R215 (≠ A273)
- binding hypoxanthine: G91 (= G120), F158 (≠ K222), V176 (≠ F240), M178 (= M242)
4da8A Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with 8-bromoguanosine (see paper)
27% identity, 92% coverage: 20:288/292 of query aligns to 3:230/231 of 4da8A
- active site: H3 (= H20), G19 (= G36), R23 (= R40), R42 (= R58), E74 (= E90), R86 (= R115), S89 (≠ T118), S201 (≠ I265), D202 (≠ A266), V204 (≠ R268), R215 (≠ A273)
- binding 8-bromoguanosine: S89 (≠ T118), G91 (= G120), F158 (≠ K222), V176 (≠ F240), E177 (= E241), M178 (= M242), E179 (= E243), S201 (≠ I265)
4da7A Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with aciclovir (see paper)
27% identity, 92% coverage: 20:288/292 of query aligns to 3:230/231 of 4da7A
- active site: H3 (= H20), G19 (= G36), R23 (= R40), R42 (= R58), E74 (= E90), R86 (= R115), S89 (≠ T118), S201 (≠ I265), D202 (≠ A266), V204 (≠ R268), R215 (≠ A273)
- binding 9-hyroxyethoxymethylguanine: C90 (= C119), G91 (= G120), F158 (≠ K222), V176 (≠ F240), M178 (= M242), E179 (= E243)
- binding phosphate ion: G19 (= G36), R86 (= R115), S89 (≠ T118)
4da6A Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with ganciclovir (see paper)
27% identity, 92% coverage: 20:288/292 of query aligns to 3:230/231 of 4da6A
- active site: H3 (= H20), G19 (= G36), R23 (= R40), R42 (= R58), E74 (= E90), R86 (= R115), S89 (≠ T118), S201 (≠ I265), D202 (≠ A266), V204 (≠ R268), R215 (≠ A273)
- binding 9-(1,3-dihydroxy-propoxymethane)guanine: S89 (≠ T118), C90 (= C119), G91 (= G120), F158 (≠ K222), V176 (≠ F240), M178 (= M242), E179 (= E243), S201 (≠ I265)
4d9hA Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with adenosine (see paper)
27% identity, 92% coverage: 20:288/292 of query aligns to 3:230/231 of 4d9hA
- active site: H3 (= H20), G19 (= G36), R23 (= R40), R42 (= R58), E74 (= E90), R86 (= R115), S89 (≠ T118), S201 (≠ I265), D202 (≠ A266), V204 (≠ R268), R215 (≠ A273)
- binding adenosine: M63 (≠ I79), S89 (≠ T118), C90 (= C119), G91 (= G120), F158 (≠ K222), V176 (≠ F240), M178 (= M242), E179 (= E243), S201 (≠ I265)
4d8vA Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis at ph 4.2 (see paper)
27% identity, 92% coverage: 20:288/292 of query aligns to 3:230/231 of 4d8vA
- active site: H3 (= H20), G19 (= G36), R23 (= R40), R42 (= R58), E74 (= E90), R86 (= R115), S89 (≠ T118), S201 (≠ I265), D202 (≠ A266), V204 (≠ R268), R215 (≠ A273)
- binding adenine: G91 (= G120), F158 (≠ K222), V176 (≠ F240), E177 (= E241), M178 (= M242)
4danA Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with 2-fluoroadenosine (see paper)
28% identity, 88% coverage: 20:276/292 of query aligns to 3:212/229 of 4danA
- active site: H3 (= H20), G19 (= G36), R23 (= R40), R42 (= R58), E74 (= E90), R86 (= R115), S89 (≠ T118), S201 (≠ I265), D202 (≠ A266), V204 (≠ R268)
- binding 2-(6-amino-2-fluoro-purin-9-yl)-5-hydroxymethyl-tetrahydro-furan-3,4-diol: H3 (= H20), R42 (= R58), S89 (≠ T118), C90 (= C119), G91 (= G120), F158 (≠ K222), V176 (≠ F240), E177 (= E241), M178 (= M242), E179 (= E243), S201 (≠ I265)
Sites not aligning to the query:
1jdsA 5'-deoxy-5'-methylthioadenosine phosphorylase complex with phosphate (space group p21) (see paper)
24% identity, 91% coverage: 20:284/292 of query aligns to 3:224/226 of 1jdsA
- active site: H3 (= H20), G19 (= G36), R23 (= R40), R41 (= R58), E73 (= E90), R84 (= R115), T87 (= T118), S202 (vs. gap), D203 (vs. gap), L205 (≠ I265), L209 (= L269)
- binding phosphate ion: G19 (= G36), R23 (= R40), R84 (= R115), G86 (= G117), T87 (= T118)
1jdvA Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with adenosine and sulfate ion (see paper)
24% identity, 91% coverage: 20:284/292 of query aligns to 4:225/227 of 1jdvA
- active site: H4 (= H20), G20 (= G36), R24 (= R40), R42 (= R58), E74 (= E90), R85 (= R115), T88 (= T118), S203 (vs. gap), D204 (vs. gap), L206 (≠ I265), L210 (= L269)
- binding adenosine: T88 (= T118), T89 (≠ C119), F159 (= F206), E162 (≠ K222), V178 (≠ F240), E179 (= E241), M180 (= M242), E181 (= E243), D204 (vs. gap)
- binding sulfate ion: G20 (= G36), R24 (= R40), R85 (= R115), G87 (= G117), T88 (= T118)
1jdzA Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase with formycin b and sulfate ion (see paper)
24% identity, 91% coverage: 20:284/292 of query aligns to 3:224/226 of 1jdzA
- active site: H3 (= H20), G19 (= G36), R23 (= R40), R41 (= R58), E73 (= E90), R84 (= R115), T87 (= T118), S202 (vs. gap), D203 (vs. gap), L205 (≠ I265), L209 (= L269)
- binding formycin b: I62 (= I79), T87 (= T118), T88 (≠ C119), G89 (= G120), V177 (≠ F240), E178 (= E241), M179 (= M242), E180 (= E243)
- binding sulfate ion: G19 (= G36), R23 (= R40), R84 (= R115), G86 (= G117), T87 (= T118)
4yjkA Crystal structure of c212s mutant of shewanella oneidensis mr-1 uridine phosphorylase (see paper)
27% identity, 87% coverage: 18:272/292 of query aligns to 3:224/245 of 4yjkA
- active site: H5 (= H20), G23 (= G36), R27 (= R40), R45 (= R58), E77 (= E90), R88 (= R115), T91 (= T118), R165 (= R212), I217 (= I265), V218 (≠ A266), R220 (= R268)
- binding uracil: T91 (= T118), T92 (≠ C119), G93 (= G120), F159 (= F206), Q163 (= Q210), R165 (= R212), E193 (= E241)
6k8pA Structural and catalytic analysis of two diverse uridine phosphorylases in the oomycete phytophthora capsici. (see paper)
26% identity, 91% coverage: 4:269/292 of query aligns to 2:264/294 of 6k8pA
- binding phosphate ion: G34 (= G36), R103 (= R115), T106 (= T118)
- binding 1-O-phosphono-alpha-D-ribofuranose: H18 (= H20), R58 (= R58)
- binding thymidine: M79 (≠ I79), T106 (= T118), C107 (= C119), G108 (= G120), F201 (= F206), Q205 (= Q210), R207 (= R212), E234 (= E241), M235 (= M242)
6k5kA Structural and catalytic analysis of two diverse uridine phosphorylases in the oomycete phytophthora capsici. (see paper)
27% identity, 88% coverage: 13:269/292 of query aligns to 4:257/287 of 6k5kA
- binding 2'-deoxyuridine: H11 (= H20), R51 (= R58), M72 (≠ I79), T99 (= T118), C100 (= C119), G101 (= G120), F194 (= F206), Q198 (= Q210), R200 (= R212), E227 (= E241)
- binding phosphate ion: G27 (= G36), R96 (= R115), G98 (= G117), T99 (= T118)
6k5hA Structural and catalytic analysis of two diverse uridine phosphorylases in the oomycete phytophthora capsici. (see paper)
27% identity, 88% coverage: 13:269/292 of query aligns to 4:257/287 of 6k5hA
- binding 1-O-phosphono-alpha-D-ribofuranose: H11 (= H20), G27 (= G36), R31 (= R40), R51 (= R58), M72 (≠ I79), R96 (= R115), T99 (= T118), F194 (= F206), M228 (= M242), E229 (= E243)
- binding uracil: C100 (= C119), G101 (= G120), F194 (= F206), Q198 (= Q210), R200 (= R212)
4r2wD X-ray structure of uridine phosphorylase from shewanella oneidensis mr-1 in complex with uridine at 1.6 a resolution (see paper)
27% identity, 87% coverage: 18:272/292 of query aligns to 3:224/251 of 4r2wD
- active site: H5 (= H20), G23 (= G36), R27 (= R40), R45 (= R58), E77 (= E90), R88 (= R115), T91 (= T118), R165 (= R212), I217 (= I265), V218 (≠ A266), R220 (= R268)
- binding glycerol: T91 (= T118), N130 (≠ H165), M194 (= M242), E195 (= E243), A204 (≠ R252)
- binding sulfate ion: G23 (= G36), R27 (= R40), R88 (= R115), G90 (= G117), T91 (= T118)
Sites not aligning to the query:
Query Sequence
>354080 FitnessBrowser__Btheta:354080
MKKYFPSSELIINEDGSVFHLHVKPEWLADKVILVGDPGRVALVASHFENKECEVESREF
KTITGTYKGKRITVVSTGIGCDNIDIVMNELDALANINFETREEKEKFRQLELVRIGTCG
GLQPNTPVGTFVCSQKSIGFDGLLNFYAGRNAVCDLPFERAFLNHMGWSGNMCAPAPYVI
DASEELIDRIAKEDMVRGVTIAAGGFFGPQGRELRIPLADPKQNDKIEAFEYKGFKITNF
EMESSALAGLSRLMGHKAMTVCMVIANRLIKEANTGYKNTIDTLIKTVLDRI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory