SitesBLAST
Comparing 3606773 FitnessBrowser__Dino:3606773 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6es9A Methylsuccinyl-coa dehydrogenase of paracoccus denitrificans with bound flavin adenine dinucleotide (see paper)
73% identity, 95% coverage: 30:563/564 of query aligns to 18:544/545 of 6es9A
- active site: F281 (= F299), T282 (= T300), A408 (= A427), R541 (= R560)
- binding coenzyme a: R75 (≠ T87), F467 (= F486), W470 (≠ F489)
- binding flavin-adenine dinucleotide: Q50 (= Q62), A279 (= A297), F281 (= F299), T282 (= T300), G287 (= G305), S288 (= S306), W312 (= W331), I313 (= I332), T314 (= T333), E374 (= E393), R434 (= R453), Q436 (= Q455), F437 (= F456), L441 (= L460), F444 (= F463), Q502 (= Q521), I503 (= I522), G505 (= G524), G506 (= G525), F528 (= F547), A531 (= A550), E533 (= E552), I534 (= I553)
8ciwA Methylsuccinyl-coa dehydrogenase from pseudomonas migulae with bound fad and (2s)-methylsuccinyl-coa (see paper)
42% identity, 74% coverage: 144:563/564 of query aligns to 119:547/555 of 8ciwA
- binding flavin-adenine dinucleotide: I275 (≠ A297), I277 (≠ F299), T278 (= T300), G283 (= G305), S284 (= S306), W308 (= W331), T310 (= T333), R437 (= R453), V439 (≠ Q455), F440 (= F456), L444 (= L460), Q504 (= Q521), I505 (= I522), G508 (= G525), F530 (= F547), E535 (= E552), T536 (≠ I553)
- binding (2S)-Methylsuccinyl-CoA: R242 (= R264), S284 (= S306), V286 (≠ L308), H332 (= H354), Y370 (= Y388), F401 (= F417), Y402 (≠ K418), M405 (= M421), M408 (≠ F424), R412 (= R428), R418 (= R434), F530 (= F547), E531 (= E548), G532 (= G549), R544 (= R560)
Sites not aligning to the query:
4iv6B X-ray crystal structure of an isovaleryl-coa dehydrogenase from mycobacterium smegmatis (see paper)
39% identity, 68% coverage: 179:563/564 of query aligns to 2:376/383 of 4iv6B
- active site: L121 (≠ F299), T122 (= T300), G240 (≠ A427), E361 (= E548), K373 (≠ R560)
- binding dihydroflavine-adenine dinucleotide: L121 (≠ F299), T122 (= T300), G126 (≠ T304), G127 (= G305), S128 (= S306), W152 (= W331), I153 (= I332), S154 (≠ T333), R266 (= R453), S268 (≠ Q455), F269 (= F456), I273 (≠ L460), H276 (≠ F463), V279 (= V466), R334 (≠ Q521), V335 (≠ I522), G338 (= G525), L356 (≠ I543), G360 (≠ F547), T363 (≠ A550), E365 (= E552), I366 (= I553)
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
38% identity, 68% coverage: 182:563/564 of query aligns to 7:377/378 of 5ol2F
- active site: L124 (≠ F299), T125 (= T300), G241 (≠ A427), G374 (≠ R560)
- binding calcium ion: E29 (= E204), E33 (≠ D209), R35 (≠ L211)
- binding coenzyme a persulfide: L238 (≠ F424), R242 (= R428), E362 (= E548), G363 (= G549)
- binding flavin-adenine dinucleotide: F122 (≠ A297), L124 (≠ F299), T125 (= T300), P127 (= P302), T131 (≠ S306), F155 (≠ W331), I156 (= I332), T157 (= T333), E198 (≠ I383), R267 (= R453), F270 (= F456), L274 (= L460), F277 (= F463), Q335 (= Q521), L336 (≠ I522), G338 (= G524), G339 (= G525), Y361 (≠ F547), T364 (≠ A550), E366 (= E552)
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
35% identity, 68% coverage: 179:563/564 of query aligns to 5:377/379 of 1ukwB
- active site: L124 (≠ F299), S125 (≠ T300), T241 (≠ A427), E362 (= E548), R374 (= R560)
- binding cobalt (ii) ion: D145 (= D322), H146 (vs. gap)
- binding flavin-adenine dinucleotide: F122 (≠ A297), L124 (≠ F299), S125 (≠ T300), G130 (= G305), S131 (= S306), W155 (= W331), S157 (≠ T333), K200 (≠ G381), L357 (≠ I543), Y361 (≠ F547), E362 (= E548), T364 (≠ A550), E366 (= E552), L370 (≠ Q556)
1ukwA Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
35% identity, 68% coverage: 179:563/564 of query aligns to 5:377/379 of 1ukwA
- active site: L124 (≠ F299), S125 (≠ T300), T241 (≠ A427), E362 (= E548), R374 (= R560)
- binding flavin-adenine dinucleotide: F122 (≠ A297), L124 (≠ F299), S125 (≠ T300), G130 (= G305), S131 (= S306), W155 (= W331), S157 (≠ T333), L357 (≠ I543), Y361 (≠ F547), E362 (= E548), T364 (≠ A550), E366 (= E552), L370 (≠ Q556)
5lnxD Crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
37% identity, 67% coverage: 185:564/564 of query aligns to 8:374/374 of 5lnxD
- active site: L122 (≠ F299), T123 (= T300), G239 (≠ A427), E358 (= E548), K370 (≠ R560)
- binding flavin-adenine dinucleotide: L122 (≠ F299), T123 (= T300), G128 (= G305), S129 (= S306), F153 (≠ W331), T155 (= T333), R265 (= R453), Q267 (= Q455), F268 (= F456), I272 (≠ L460), N275 (≠ F463), I278 (≠ V466), Q331 (= Q521), I332 (= I522), G335 (= G525), Y357 (≠ F547), T360 (≠ A550), E362 (= E552)
8i4rA Crystal structure of acyl-coa dehydrogenase complexed with acetyl-coa from thermobifida fusca
34% identity, 68% coverage: 181:563/564 of query aligns to 8:380/381 of 8i4rA
- binding acetyl coenzyme *a: S132 (= S306), T134 (≠ L308), R180 (= R355), R234 (≠ K418), L237 (≠ M421), R238 (≠ E422), L240 (≠ F424), D241 (≠ E425), R244 (= R428), E365 (= E548), G366 (= G549), R377 (= R560)
- binding flavin-adenine dinucleotide: Y123 (≠ A297), L125 (≠ F299), S126 (≠ T300), G131 (= G305), S132 (= S306), W156 (= W331), I157 (= I332), T158 (= T333), I360 (= I543), T367 (≠ A550), Q369 (≠ E552)
8i4pA Crystal structure of acyl-coa dehydrogenase from thermobifida fusca
34% identity, 68% coverage: 181:563/564 of query aligns to 8:380/381 of 8i4pA
- binding flavin-adenine dinucleotide: Y123 (≠ A297), L125 (≠ F299), S126 (≠ T300), G131 (= G305), S132 (= S306), W156 (= W331), I157 (= I332), T158 (= T333), I360 (= I543), Y364 (≠ F547), T367 (≠ A550), Q369 (≠ E552)
7w0jE Acyl-coa dehydrogenase, tfu_1647
34% identity, 68% coverage: 181:563/564 of query aligns to 9:381/382 of 7w0jE
- binding [[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2R,3S,4S)-5-azanyl-2,3,4-tris(oxidanyl)pentyl] hydrogen phosphate: S127 (≠ T300), W157 (= W331), R270 (= R453), Q272 (= Q455), F273 (= F456), I277 (≠ L460), F280 (= F463), I283 (≠ V466), Q339 (= Q521), L340 (≠ I522), G343 (= G525), Y365 (≠ F547), E366 (= E548), T368 (≠ A550), Q370 (≠ E552), I371 (= I553)
4n5fA Crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315
34% identity, 68% coverage: 181:562/564 of query aligns to 8:378/378 of 4n5fA
- active site: L126 (≠ F299), T127 (= T300), G243 (≠ A427), E364 (= E548), R376 (= R560)
- binding dihydroflavine-adenine dinucleotide: L126 (≠ F299), T127 (= T300), G132 (= G305), S133 (= S306), F157 (≠ W331), T159 (= T333), T210 (≠ E393), Y363 (≠ F547), T366 (≠ A550), E368 (= E552), M372 (≠ Q556)
8phfA Cryo-em structure of human acad9-s191a (see paper)
37% identity, 62% coverage: 212:559/564 of query aligns to 56:400/547 of 8phfA
- binding flavin-adenine dinucleotide: T144 (= T300), W176 (= W331), K225 (≠ V385), R292 (= R453), Q294 (= Q455), F295 (= F456), F302 (= F463), L304 (≠ R465), I305 (≠ V466), I363 (= I522), G365 (= G524), G366 (= G525), F388 (= F547), E393 (= E552), M397 (≠ Q556)
Sites not aligning to the query:
P41367 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial; MCAD; EC 1.3.8.7 from Sus scrofa (Pig) (see 2 papers)
34% identity, 69% coverage: 177:564/564 of query aligns to 35:417/421 of P41367
- 158:167 (vs. 297:306, 50% identical) binding in other chain
- S167 (= S306) binding
- WIT 191:193 (= WIT 331:333) binding in other chain
- S216 (≠ H354) binding
- D278 (≠ E425) binding
- R281 (= R428) binding
- RKT 306:308 (≠ RKQ 453:455) binding
- HQ 316:317 (≠ FP 463:464) binding in other chain
- R349 (= R496) binding
- T351 (≠ D498) binding
- QVFGG 374:378 (≠ QIHGG 521:525) binding
- E401 (= E548) active site, Proton acceptor; binding
- GTAQ 402:405 (≠ GAAE 549:552) binding in other chain
3mdeA Crystal structures of medium chain acyl-coa dehydrogenase from pig liver mitochondria with and without substrate (see paper)
34% identity, 69% coverage: 178:564/564 of query aligns to 1:382/385 of 3mdeA
- active site: V125 (≠ F299), T126 (= T300), T245 (≠ A427), E366 (= E548), R378 (= R560)
- binding octanoyl-coenzyme a: T86 (≠ S260), E89 (≠ T263), L93 (≠ I267), S132 (= S306), V134 (≠ L308), S181 (≠ H354), F235 (= F417), M239 (= M421), F242 (= F424), R314 (= R496), Y365 (≠ F547), E366 (= E548), G367 (= G549)
- binding flavin-adenine dinucleotide: Y123 (≠ A297), V125 (≠ F299), T126 (= T300), G131 (= G305), S132 (= S306), W156 (= W331), I157 (= I332), T158 (= T333), R271 (= R453), T273 (≠ Q455), F274 (= F456), L278 (= L460), H281 (≠ F463), Q339 (= Q521), V340 (≠ I522), G343 (= G525), I361 (= I543), T368 (≠ A550), Q370 (≠ E552)
3mddA Crystal structures of medium chain acyl-coa dehydrogenase from pig liver mitochondria with and without substrate (see paper)
34% identity, 69% coverage: 178:564/564 of query aligns to 1:382/385 of 3mddA
- active site: V125 (≠ F299), T126 (= T300), T245 (≠ A427), E366 (= E548), R378 (= R560)
- binding flavin-adenine dinucleotide: Y123 (≠ A297), T126 (= T300), G131 (= G305), S132 (= S306), W156 (= W331), T158 (= T333), R271 (= R453), T273 (≠ Q455), F274 (= F456), H281 (≠ F463), Q339 (= Q521), V340 (≠ I522), G343 (= G525), I361 (= I543), T368 (≠ A550), Q370 (≠ E552)
1udyA Medium-chain acyl-coa dehydrogenase with 3-thiaoctanoyl-coa (see paper)
34% identity, 69% coverage: 178:564/564 of query aligns to 1:382/385 of 1udyA
- active site: V125 (≠ F299), T126 (= T300), T245 (≠ A427), E366 (= E548), R378 (= R560)
- binding 3-thiaoctanoyl-coenzyme a: L93 (≠ I267), Y123 (≠ A297), S132 (= S306), S181 (≠ H354), F235 (= F417), M239 (= M421), F242 (= F424), V249 (≠ T431), R314 (= R496), Y365 (≠ F547), E366 (= E548), G367 (= G549), I371 (= I553), I375 (≠ V557)
- binding flavin-adenine dinucleotide: Y123 (≠ A297), T126 (= T300), G131 (= G305), S132 (= S306), W156 (= W331), T158 (= T333), T273 (≠ Q455), F274 (= F456), Q339 (= Q521), V340 (≠ I522), G343 (= G525), T368 (≠ A550), Q370 (≠ E552)
Q9H845 Complex I assembly factor ACAD9, mitochondrial; Acyl-CoA dehydrogenase family member 9; ACAD-9; EC 1.3.8.- from Homo sapiens (Human) (see 4 papers)
37% identity, 62% coverage: 212:559/564 of query aligns to 93:437/621 of Q9H845
- R193 (= R312) to W: in MC1DN20; uncertain significance; dbSNP:rs377547811
- S234 (≠ P349) to F: in MC1DN20; uncertain significance
- G303 (≠ A427) to S: in MC1DN20; uncertain significance; dbSNP:rs143383023
- A326 (= A450) to T: in MC1DN20; uncertain significance; dbSNP:rs115532916
- E413 (≠ S535) to K: in MC1DN20; uncertain significance; dbSNP:rs149753643
- E426 (= E548) mutation to Q: Loss of long-chain-acyl-CoA dehydrogenase activity. Does not affect mitochondrial complex I assembly.
Sites not aligning to the query:
- 1:37 modified: transit peptide, Mitochondrion
1jqiA Crystal structure of rat short chain acyl-coa dehydrogenase complexed with acetoacetyl-coa (see paper)
34% identity, 68% coverage: 179:563/564 of query aligns to 7:380/384 of 1jqiA
- active site: G377 (≠ R560)
- binding acetoacetyl-coenzyme a: L95 (≠ I267), F125 (≠ A297), S134 (= S306), F234 (= F417), M238 (= M421), Q239 (≠ E422), L241 (≠ F424), D242 (≠ E425), R245 (= R428), Y364 (≠ F547), E365 (= E548), G366 (= G549)
- binding flavin-adenine dinucleotide: F125 (≠ A297), L127 (≠ F299), S128 (≠ T300), G133 (= G305), S134 (= S306), W158 (= W331), T160 (= T333), R270 (= R453), F273 (= F456), L280 (≠ F463), Q338 (= Q521), I339 (= I522), G342 (= G525), I360 (= I543), T367 (≠ A550), E369 (= E552), I370 (= I553)
P15651 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Rattus norvegicus (Rat) (see 2 papers)
34% identity, 68% coverage: 179:563/564 of query aligns to 34:407/412 of P15651
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
8pheA Acad9-wt in complex with ecsit-cter (see paper)
37% identity, 62% coverage: 212:559/564 of query aligns to 56:400/551 of 8pheA
- binding : L143 (≠ F299), D151 (= D307), A153 (≠ G309), S154 (≠ A310), I155 (≠ L311), K202 (≠ H354), I205 (≠ L357), F256 (= F417), M260 (= M421), F295 (= F456), N296 (≠ G457), I394 (= I553), Y398 (≠ V557)
Sites not aligning to the query:
Query Sequence
>3606773 FitnessBrowser__Dino:3606773
MPHDGQDLSLNDAQTVVLPDLLNLTAAAVPPVEAVLEKAVAILKTQLAVDGRISGALVEE
HQTASHGLAWLATYAQSLRQMQKWAETLQADGKFGEVEQLIHQIAFGEYLWQLYGGIPMS
QGEILRLQDIGLSQDDQRGLMTPEIQTLTRSGNTQAARTRLVELMQERAAEITVGATGLD
DELEMIREQFRRFSVDKVEPHAHEWHLKDELIPMEIIEELAEMGVFGLTIPEEYGGFGLS
KASMCVVSEELSRGYIGVGSLGTRSEIAAELIICGGTEEQKQKWLPRLASAETLPTAVFT
EPNTGSDLGALRTRAVQDENGDWKVTGNKTWITHAARTHVMTLLARTKPDTTDHRGLSMF
LAEKTPGTDEAPFPTEGMTGGEIEVLGYRGMKEYELAFDNFHVKGENLLGGEEGKGFKQL
METFESARIQTAARAIGVAQSALDVSMQYAIDRKQFGKSLINFPRVSGKLAMMAVEIMVA
RQLTYFSAFEKDEGRRCDVEAGMAKLLGARVAWAAADNGLQIHGGNGFALEYGISRILCD
ARILNIFEGAAEIQAQVIARRLLG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory