SitesBLAST
Comparing 3607862 FitnessBrowser__Dino:3607862 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5yaqB Crystal structure of scyllo-inositol dehydrogenase with l-glucose dehydrogenase activity complexed with scyllo-inosose (see paper)
42% identity, 96% coverage: 4:360/372 of query aligns to 2:362/366 of 5yaqB
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K100 (= K103), Y129 (= Y132), Y157 (≠ H160), E159 (= E162), R172 (= R175), D185 (= D186), H189 (= H190)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), T9 (≠ G11), G10 (= G12), F11 (≠ Y13), M12 (= M14), D39 (≠ A42), M40 (≠ S43), T76 (≠ A79), T77 (≠ S80), N79 (≠ Q82), H82 (= H85), E99 (= E102), K100 (= K103), N128 (= N131), R172 (= R175), H189 (= H190)
5ya8A Crystal structure of scyllo-inositol dehydrogenase with l-glucose dehydrogenase activity complexed with myo-inositol (see paper)
42% identity, 96% coverage: 4:360/372 of query aligns to 2:362/366 of 5ya8A
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K100 (= K103), Y129 (= Y132), Y157 (≠ H160), E159 (= E162), R172 (= R175), D185 (= D186), H189 (= H190)
- binding nicotinamide-adenine-dinucleotide: T9 (≠ G11), G10 (= G12), F11 (≠ Y13), M12 (= M14), D39 (≠ A42), M40 (≠ S43), T76 (≠ A79), T77 (≠ S80), P78 (= P81), N79 (≠ Q82), H82 (= H85), E99 (= E102), K100 (= K103), N128 (= N131), H189 (= H190)
6ktkC Crystal structure of scyllo-inositol dehydrogenase r178a mutant, complexed with nadh and l-glucono-1,5-lactone, from paracoccus laeviglucosivorans (see paper)
42% identity, 96% coverage: 4:360/372 of query aligns to 3:363/368 of 6ktkC
- binding L-glucono-1,5-lactone: K101 (= K103), Y130 (= Y132), Y158 (≠ H160), E160 (= E162), Y162 (≠ F164), D186 (= D186), H190 (= H190)
- binding 1,4-dihydronicotinamide adenine dinucleotide: T10 (≠ G11), G11 (= G12), F12 (≠ Y13), M13 (= M14), D40 (≠ A42), M41 (≠ S43), T77 (≠ A79), T78 (≠ S80), N80 (≠ Q82), H83 (= H85), E100 (= E102), K101 (= K103), N129 (= N131), H190 (= H190)
6a3iA Levoglucosan dehydrogenase, complex with nadh and levoglucosan (see paper)
40% identity, 98% coverage: 3:367/372 of query aligns to 2:372/372 of 6a3iA
- binding Levoglucosan: K103 (= K103), Y132 (= Y132), Y160 (≠ H160), Q162 (≠ E162), R175 (= R175), D188 (= D186), H192 (= H190)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F12 (≠ Y13), M13 (= M14), E42 (≠ A41), A43 (= A42), P81 (= P81), N82 (≠ Q82), L84 (≠ T84), H85 (= H85), E102 (= E102), K103 (= K103), W174 (= W174), R175 (= R175)
6a3jC Levoglucosan dehydrogenase, complex with nadh and l-sorbose (see paper)
40% identity, 98% coverage: 3:367/372 of query aligns to 1:376/378 of 6a3jC
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G12), F11 (≠ Y13), M12 (= M14), E41 (≠ A41), T79 (≠ S80), P80 (= P81), N81 (≠ Q82), H84 (= H85), E101 (= E102), K102 (= K103), W173 (= W174), R174 (= R175)
- binding alpha-L-sorbopyranose: K102 (= K103), Y131 (= Y132), Y159 (≠ H160), Q161 (≠ E162), W163 (≠ F164), R174 (= R175), D187 (= D186)
F0M433 Levoglucosan dehydrogenase; LGDH; 1,6-anhydro-beta-D-glucose dehydrogenase; PpLGDH; EC 1.1.1.425 from Pseudarthrobacter phenanthrenivorans (strain DSM 18606 / JCM 16027 / LMG 23796 / Sphe3) (Arthrobacter phenanthrenivorans) (see paper)
39% identity, 99% coverage: 1:367/372 of query aligns to 1:388/390 of F0M433
- F13 (≠ Y13) binding
- M14 (= M14) binding
- E43 (≠ A41) binding
- T81 (≠ S80) binding
- N83 (≠ Q82) binding
- H86 (= H85) binding
- E103 (= E102) binding
- K104 (= K103) binding ; binding
- A130 (≠ G129) binding
- N132 (= N131) binding
- Y133 (= Y132) binding
- Q163 (≠ E162) binding
- W175 (= W174) binding
- R176 (= R175) binding ; binding
- D189 (= D186) binding
- H193 (= H190) binding
- Y335 (= Y314) binding
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
28% identity, 99% coverage: 4:371/372 of query aligns to 2:340/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (≠ Y13), F152 (≠ Y165), N154 (≠ D167), D175 (= D186), L176 (= L187), H179 (= H190), E236 (≠ K251), W271 (≠ L293)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G12), F11 (≠ Y13), M12 (= M14), D33 (≠ E38), L34 (≠ M39), T70 (≠ A79), T71 (≠ S80), P72 (= P81), N73 (≠ Q82), L75 (≠ T84), H76 (= H85), Q79 (≠ I88), E93 (= E102), K94 (= K103), N122 (= N131), W161 (= W174), H179 (= H190), Y290 (≠ H310)
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
28% identity, 99% coverage: 4:371/372 of query aligns to 2:340/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: F11 (≠ Y13), N154 (≠ D167), D175 (= D186), H179 (= H190), E236 (≠ K251), W271 (≠ L293)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G10), G10 (= G12), F11 (≠ Y13), M12 (= M14), D33 (≠ E38), L34 (≠ M39), T70 (≠ A79), T71 (≠ S80), P72 (= P81), N73 (≠ Q82), L75 (≠ T84), H76 (= H85), Q79 (≠ I88), E93 (= E102), K94 (= K103), N122 (= N131), W161 (= W174), Y290 (≠ H310)
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
28% identity, 99% coverage: 4:371/372 of query aligns to 2:340/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: G10 (= G12), F11 (≠ Y13), M12 (= M14), D33 (≠ E38), L34 (≠ M39), T70 (≠ A79), T71 (≠ S80), P72 (= P81), N73 (≠ Q82), L75 (≠ T84), H76 (= H85), Q79 (≠ I88), E93 (= E102), K94 (= K103), N122 (= N131), W161 (= W174), H179 (= H190), Y290 (≠ H310)
7d5nA Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
28% identity, 59% coverage: 58:275/372 of query aligns to 64:282/379 of 7d5nA
Sites not aligning to the query:
B9JK80 D-apiose dehydrogenase; EC 1.1.1.420 from Rhizobium rhizogenes (strain K84 / ATCC BAA-868) (Agrobacterium radiobacter)
25% identity, 99% coverage: 1:367/372 of query aligns to 3:344/345 of B9JK80
- FF 15:16 (≠ Y- 13) binding
- W24 (vs. gap) binding
- K25 (vs. gap) binding
- V27 (= V20) binding
- A30 (= A23) binding
- D37 (≠ N30) binding
- S79 (≠ T84) binding
- QK 97:98 (≠ EK 102:103) binding
- N126 (= N131) binding
- QPY 165:167 (≠ PAM 168:170) binding
5uiaA Crystal structure of an oxidoreductase from agrobacterium radiobacter in complex with NAD+, r-2,3-dihydroxyisovalerate and magnesium
25% identity, 98% coverage: 4:367/372 of query aligns to 8:341/342 of 5uiaA
- binding (2S)-2,3-dihydroxy-3-methylbutanoic acid: K95 (= K103), Q162 (≠ P168), D175 (= D186), H179 (= H190), Y229 (= Y242)
- binding magnesium ion: W21 (≠ A17), K22 (≠ H18), V24 (= V20), A27 (= A23)
- binding nicotinamide-adenine-dinucleotide: F12 (≠ I8), F13 (≠ V9), D34 (≠ N30), R35 (= R32), T72 (≠ S80), Q94 (≠ E102), K95 (= K103), N123 (= N131), Q162 (≠ P168), Y164 (≠ M170)
5ui9A Crystal structure of an oxidoreductase from agrobacterium radiobacter in complex with NAD+, 2 -hydroxy-2-hydroxymethyl propanoic acid and magnesium
25% identity, 98% coverage: 4:367/372 of query aligns to 8:341/342 of 5ui9A
- binding (2S)-2,3-dihydroxy-2-methylpropanoic acid: K95 (= K103), Q162 (≠ P168), D175 (= D186), H179 (= H190), Y229 (= Y242), W285 (≠ G309)
- binding magnesium ion: W21 (≠ A17), K22 (≠ H18), V24 (= V20), A27 (= A23)
- binding nicotinamide-adenine-dinucleotide: F12 (≠ I8), F13 (≠ V9), D34 (≠ N30), R35 (= R32), T72 (≠ S80), S76 (≠ T84), Q94 (≠ E102), K95 (= K103), P96 (= P104), N123 (= N131), Q162 (≠ P168), Y164 (≠ M170)
5uhzA Crystal structure of an oxidoreductase from agrobacterium radiobacter in complex with NAD+, d-apionate and magnesium
25% identity, 98% coverage: 4:367/372 of query aligns to 8:341/342 of 5uhzA
- binding (3R,4R)-3,4-dihydroxy-4-(hydroxymethyl)oxolan-2-one: K95 (= K103), Q162 (≠ P168), D175 (= D186), H179 (= H190), Y229 (= Y242)
- binding magnesium ion: W21 (≠ A17), K22 (≠ H18), V24 (= V20), A27 (= A23)
- binding nicotinamide-adenine-dinucleotide: G11 (= G7), F12 (≠ I8), F13 (≠ V9), D34 (≠ N30), R35 (= R32), T72 (≠ S80), S76 (≠ T84), Q94 (≠ E102), K95 (= K103), P96 (= P104), N123 (= N131), Q162 (≠ P168), Y164 (≠ M170)
5uhwA Crystal structure of an oxidoreductase from agrobacterium radiobacter in complex with NAD+ and magnesium
25% identity, 98% coverage: 4:367/372 of query aligns to 8:341/342 of 5uhwA
- binding magnesium ion: W21 (≠ A17), K22 (≠ H18), V24 (= V20), A27 (= A23)
- binding nicotinamide-adenine-dinucleotide: G11 (= G7), F12 (≠ I8), F13 (≠ V9), D34 (≠ N30), R35 (= R32), T72 (≠ S80), Q94 (≠ E102), K95 (= K103), N123 (= N131), Q162 (≠ P168)
7d5nB Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
28% identity, 59% coverage: 58:275/372 of query aligns to 64:291/389 of 7d5nB
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K114 (= K103), Y143 (= Y132), R190 (= R175), D204 (= D186), H208 (= H190)
- binding 1,4-dihydronicotinamide adenine dinucleotide: T91 (≠ S80), P92 (= P81), N93 (≠ Q82), H96 (= H85), E113 (= E102), K114 (= K103), W189 (= W174), R190 (= R175), H208 (= H190)
Sites not aligning to the query:
7d5mA Crystal structure of inositol dehydrogenase homolog complexed with NAD+ from azotobacter vinelandii
28% identity, 59% coverage: 58:275/372 of query aligns to 65:292/389 of 7d5mA
Sites not aligning to the query:
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
29% identity, 75% coverage: 4:282/372 of query aligns to 3:275/340 of 4n54A
- active site: K96 (= K103), H183 (= H190)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: R12 (≠ Y13), K96 (= K103), D156 (= D163), D179 (= D186), M180 (≠ L187), H183 (= H190), R238 (= R250), Y244 (= Y256)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V8 (= V9), G9 (= G10), L10 (≠ G11), G11 (= G12), R12 (≠ Y13), L13 (≠ M14), S35 (= S44), V36 (≠ R45), E40 (= E49), S73 (= S80), P74 (= P81), F77 (≠ T84), H78 (= H85), E95 (= E102), K96 (= K103), M125 (≠ N131), F167 (≠ W174)
Sites not aligning to the query:
3dtyA Crystal structure of an oxidoreductase from pseudomonas syringae
26% identity, 73% coverage: 73:343/372 of query aligns to 80:344/374 of 3dtyA
6o15A Crystal structure of a putative oxidoreductase yjhc from escherichia coli in complex with NAD(h) (see paper)
28% identity, 73% coverage: 4:275/372 of query aligns to 2:260/355 of 6o15A
- binding nicotinamide-adenine-dinucleotide: G10 (= G12), Y11 (= Y13), F12 (≠ M14), Y32 (≠ A41), D33 (≠ A42), A67 (= A79), T68 (≠ S80), P69 (= P81), N70 (≠ Q82), H73 (= H85), E90 (= E102), K91 (= K103), I119 (≠ N131), W160 (= W174)
Query Sequence
>3607862 FitnessBrowser__Dino:3607862
MSEIGVGIVGGGYMGKAHAVAHASVGALFNTRLRPRLEMVAASSRASAERYRAAFGFRRA
APDWETLVADPHVEAVVIASPQDTHRAIVEAAAALGKPVFCEKPLGASLEDAIAITEAAE
RAGIVNMVGFNYIRTPASQYARRLIAEGEIGEVTWFRGEHTEDFYADPAMLASWRTSGMA
NGTMGDLAPHMINAALALIGPIGAVMAEVETVHTDRNGTPVTNDDQAQMMCRFTGGAMGH
LYFSRIATGRKMGYIYEITGTRGAIRFNQEDQNSLWLYRAEGPEAERGFRQILTGPAHPD
YLPFCQGPGHGTGYQDQITIEARDFLEAIADGASRWPSFRDGLAVSHVTAAALKSHATRQ
WQDVAQLKGDPK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory